Recombinant Lactobacillus salivarius Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Description

Overview of crcB2

Protein CrcB homolog 2 (crcB2) is a 129-amino-acid transmembrane protein encoded by the crcB2 gene in L. salivarius. It belongs to the CrcB family, which is associated with fluoride ion transport and stress resistance in bacteria . Recombinant crcB2 is synthesized using an E. coli expression system, tagged with a 10xHis sequence at the N-terminus for purification .

Amino Acid Sequence

The crcB2 sequence begins with MIEVQNVKLGTLISVFFFGMIGGTLRYLLSLKLASTGTILVNLIGSFCLAFLTYYVI... and includes transmembrane domains critical for ion transport .

Domain Architecture

  • Transmembrane helices: Predicted to form 4–5 membrane-spanning regions.

  • Conserved motifs: Regions implicated in fluoride-binding (e.g., Gly/Ser-rich segments) .

Expression and Purification

  • Produced as a soluble protein in E. coli with >90% purity .

  • Tagged with a 10xHis sequence for affinity chromatography .

Fluoride Resistance

CrcB proteins mitigate fluoride toxicity by exporting fluoride ions, enhancing bacterial survival in acidic environments .

Probiotic Stress Adaptation

In L. salivarius, crcB2 may contribute to gut colonization by resisting host-derived stressors (e.g., low pH, bile salts) .

Biotechnological Potential

  • Drug Target: Inhibition of crcB2 could sensitize pathogens to fluoride-based antimicrobials.

  • Probiotic Engineering: Overexpression may improve stress tolerance in probiotic strains .

Limitations and Research Gaps

  • Functional Data: No peer-reviewed studies directly validate crcB2’s role in L. salivarius.

  • Structural Studies: Lack of crystallographic or NMR data limits mechanistic insights.

Future Directions

  • Genetic Knockout Models: To elucidate crcB2’s role in L. salivarius physiology.

  • Host-Microbe Interaction Studies: Assess impact on gut adhesion or immune modulation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly sent with blue ice packs. If you require dry ice packaging, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
crcB2; LSL_1474; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Lactobacillus salivarius (strain UCC118)
Target Names
crcB2
Target Protein Sequence
MIEVQNVKLGTLISVFFFGMIGGTLRYLLSLKLASTGTILVNLIGSFCLAFLTYYVIERQ KLPAWLSTGLGTGMVGAFTTFSTFTVDILGLSTFTDATFYLLISVVGGFLLAYTGMILGI KLGKVGDRR
Uniprot No.

Target Background

Function
Important for reducing fluoride concentration within cells, thus mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of crcB2 in Ligilactobacillus salivarius?

The crcB2 gene is part of the complex multireplicon genome architecture of Ligilactobacillus salivarius (formerly Lactobacillus salivarius). L. salivarius possesses a 1.83 Mb chromosome, a 242-kb megaplasmid (pMP118), and two smaller plasmids . While specific location data for crcB2 is not fully characterized in all strains, genomic studies indicate that strain-specific genes are often located on the megaplasmid rather than the main chromosome. Researchers investigating crcB2 should conduct comparative genomic analyses across multiple L. salivarius strains to determine conservation patterns, as the megaplasmid harbors many genes related to environmental adaptation and metabolic functions.

How does crcB2 expression vary across different environmental conditions?

Expression of membrane transport proteins like crcB2 in L. salivarius likely responds to environmental stressors. Based on studies of L. salivarius adaptation mechanisms, expression can be analyzed using transcriptomics approaches. Researchers should design experiments that expose L. salivarius cultures to varying conditions (pH levels, bile salt concentrations, different carbon sources) and measure crcB2 expression using RT-qPCR or RNA-seq methods. Current research shows that L. salivarius demonstrates remarkable adaptation to gastrointestinal tract conditions, suggesting that transporters like crcB2 may play important roles in stress response pathways .

What are the predicted structural characteristics of CrcB2 protein in L. salivarius?

CrcB homologs typically function as fluoride ion channels with multiple transmembrane domains. For L. salivarius CrcB2, researchers should employ predictive bioinformatics tools such as TMHMM for transmembrane domain prediction, Phyre2 for tertiary structure modeling, and AlphaFold for more accurate structural predictions. Comparative analysis with known CrcB structures from other bacterial species would provide valuable insights. Genomic analyses of L. salivarius have revealed genes encoding various transport systems that contribute to its environmental adaptation capabilities , suggesting CrcB2 likely contributes to ion homeostasis in this species.

What are the optimal strategies for cloning and expressing recombinant L. salivarius CrcB2?

For successful expression of L. salivarius CrcB2, researchers should consider the following methodological approach:

  • Gene Amplification: Design primers with appropriate restriction sites based on the complete genome sequence of L. salivarius .

  • Expression System Selection: For membrane proteins like CrcB2, E. coli C41(DE3) or C43(DE3) strains are recommended as they are engineered to handle toxic membrane proteins.

  • Vector Selection: pET series vectors with N-terminal His-tags are recommended, with consideration for fusion partners like MBP that enhance solubility.

  • Codon Optimization: Analyze the codon usage bias between L. salivarius and the expression host to optimize expression efficiency.

  • Induction Conditions: Test multiple induction parameters (temperature: 16-30°C; IPTG concentration: 0.1-1.0 mM; induction time: 4-24 hours).

Expression should be verified using Western blot analysis with anti-His antibodies and functional assays appropriate for ion channel activity.

What purification methods are most effective for recombinant L. salivarius CrcB2?

Purification of membrane proteins like CrcB2 requires specialized approaches:

Purification StepRecommended MethodCritical Parameters
Membrane IsolationDifferential centrifugationBuffer: 50 mM Tris-HCl, pH 7.5, 150 mM NaCl
SolubilizationDetergent extractionTest multiple detergents: DDM (0.5-1%), LMNG (0.01-0.1%), or SMA copolymers (2.5%)
Affinity ChromatographyIMAC using Ni-NTAInclude 5-10 mM imidazole in binding buffer to reduce non-specific binding
Size ExclusionSuperdex 200Buffer containing appropriate detergent at CMC
Purity AssessmentSDS-PAGE and mass spectrometry>95% purity required for structural studies

Researchers should monitor protein stability throughout purification using functional assays and optimize detergent concentrations to maintain native conformation while removing lipid contaminants.

How can functional assays be designed to characterize L. salivarius CrcB2 activity?

To assess the functional properties of purified CrcB2, researchers should consider these methodological approaches:

  • Ion Flux Assays: Reconstitute purified CrcB2 in liposomes loaded with fluorescent indicators sensitive to ion concentration changes.

  • Electrophysiology: Use planar lipid bilayer recordings to measure single-channel conductance and ion selectivity.

  • Fluoride Sensitivity Tests: Compare growth of E. coli expressing L. salivarius CrcB2 versus controls in media containing various fluoride concentrations.

  • Binding Assays: Employ isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to measure binding affinities of potential ligands.

  • Mutagenesis Studies: Create point mutations in conserved residues to identify key functional domains.

These approaches should be calibrated using known CrcB homologs from other bacterial species as positive controls.

How can omics technologies advance our understanding of CrcB2 function in L. salivarius?

Omics technologies offer powerful approaches to elucidate CrcB2 function within the broader context of L. salivarius biology:

  • Genomics: Comparative genomic analysis across L. salivarius strains can identify genetic variations in crcB2 that correlate with phenotypic differences. Complete genome sequencing has already revealed the complex architecture of L. salivarius genomes .

  • Transcriptomics: RNA-seq analysis under different environmental conditions can identify co-expressed genes and potential regulatory networks involving crcB2. Studies have shown that L. salivarius demonstrates adaptive gene expression patterns in response to environmental stresses .

  • Proteomics: Mass spectrometry-based approaches can identify post-translational modifications and protein-protein interactions involving CrcB2. Proteomic studies have been effectively applied to analyze L. salivarius responses to environmental changes .

  • Metabolomics: Metabolic profiling of wild-type versus crcB2 knockout strains can reveal the impact of CrcB2 on cellular metabolism. L. salivarius metabolomics has identified multiple metabolic pathways influenced by environmental conditions .

Integration of these multi-omics datasets using systems biology approaches would provide comprehensive insights into CrcB2 function within the cellular network of L. salivarius.

What role might CrcB2 play in the probiotic properties of L. salivarius?

L. salivarius is recognized for its probiotic properties, including gastrointestinal tract colonization, antimicrobial activity, and immunomodulation . The potential role of CrcB2 in these properties could be investigated through:

  • Knockout Studies: Generate crcB2 deletion mutants and assess changes in probiotic properties including adhesion to intestinal cells, survival in simulated gastric conditions, and antimicrobial activity.

  • Host Interaction Models: Compare wild-type and crcB2 mutant strains in cell culture models (e.g., Caco-2, HT-29) and animal models to assess colonization efficiency and host responses.

  • Stress Response Analysis: Evaluate how crcB2 contributes to L. salivarius adaptation to various environmental stresses encountered in the gastrointestinal tract.

Research has demonstrated that L. salivarius strains exhibit strong adhesion to intestinal mucosa and extracellular matrix components, which is critical for their probiotic function . Transport proteins like CrcB2 may contribute to maintaining cellular homeostasis under the challenging conditions of the gastrointestinal environment.

How does the CRISPR-Cas system in L. salivarius affect genetic manipulation of crcB2?

L. salivarius possesses multiple CRISPR-Cas systems, including I-B, I-C, I-E, II-A, and III-A types, which may impact genetic engineering approaches . Researchers should consider:

  • CRISPR Interference: The native CRISPR-Cas systems might recognize introduced DNA sequences, potentially limiting transformation efficiency. Analysis of CRISPR arrays for spacers matching planned recombinant constructs is advisable.

  • Self-targeting Concerns: Nearly one-third of L. salivarius genomes contain self-targeting spacers , which could potentially target introduced crcB2 constructs if they share sequence identity with endogenous genetic elements.

  • Strain Selection: Choose L. salivarius strains with characterized CRISPR-Cas systems for genetic manipulation work on crcB2. The specific combination of systems varies between strains, affecting their amenability to genetic modification.

  • CRISPR-based Editing: Leverage the native CRISPR-Cas systems for targeted genetic manipulation of crcB2, using strain-specific CRISPR-Cas properties for optimal results.

How should researchers address conflicting results in CrcB2 functional studies?

When encountering contradictory results in CrcB2 research, implement this systematic approach:

  • Strain Variation Analysis: Different L. salivarius strains may contain variant crcB2 genes with distinct functional properties. Comprehensive genome analysis across multiple strains has revealed significant genetic diversity in L. salivarius .

  • Experimental Condition Review: Systematically evaluate how differences in experimental conditions (pH, temperature, ion concentrations) might explain divergent results.

  • Protein Structure Verification: Confirm that the recombinant CrcB2 maintains proper folding and oligomeric state using circular dichroism, size exclusion chromatography, and other biophysical methods.

  • Heterologous Expression Effects: Consider how the choice of expression system might affect protein function, as membrane proteins often require specific lipid environments for optimal activity.

  • Meta-analysis Approach: Compile all available data on CrcB2 function using structured reporting formats and statistical methods to identify patterns across studies.

What bioinformatic approaches best support structure-function analysis of L. salivarius CrcB2?

For comprehensive structure-function analysis of CrcB2, researchers should employ these bioinformatic methods:

  • Homology Modeling: Utilize AlphaFold2 and RoseTTAFold to generate structural models based on distant homologs, with critical evaluation of model quality metrics.

  • Molecular Dynamics Simulations: Perform extended simulations (>100 ns) of CrcB2 in lipid bilayer environments to analyze conformational dynamics and ion permeation pathways.

  • Conservation Analysis: Conduct multiple sequence alignments of CrcB homologs across bacterial species to identify highly conserved residues likely critical for function.

  • Coevolution Analysis: Apply methods like direct coupling analysis (DCA) to identify co-evolving residues that may participate in allosteric networks or protein-protein interactions.

  • Protein-Ligand Docking: Use computational docking to predict binding modes of fluoride ions and potential inhibitors with the modeled CrcB2 structure.

These approaches should be integrated with experimental data from mutagenesis studies to iteratively refine structure-function models.

How can researchers integrate CrcB2 studies with broader L. salivarius genomic and metabolic research?

Integration of CrcB2 research with broader L. salivarius biology requires these methodological approaches:

  • Pangenome Analysis: Position crcB2 within the core or accessory genome of L. salivarius using comparative genomics across multiple strains. Current genomic studies have characterized the complex multireplicon architecture of L. salivarius, providing a foundation for contextualizing crcB2 .

  • Regulatory Network Mapping: Identify potential transcription factors and regulatory elements controlling crcB2 expression through promoter analysis and ChIP-seq studies.

  • Metabolic Modeling: Incorporate CrcB2 function into genome-scale metabolic models of L. salivarius to predict systemic effects of transporter activity on cellular metabolism. Metabolomics studies have already identified key pathways in L. salivarius that might be influenced by ion transport .

  • Host-Microbe Interaction Studies: Evaluate how CrcB2 function contributes to L. salivarius adaptation in host environments through transcriptomics and metabolomics of host-bacterium co-culture systems.

  • Comparative Functionality: Analyze functional complementation between CrcB2 and other transporters to understand redundancy and specialization within the L. salivarius transport system network.

What emerging technologies could advance CrcB2 structural biology research?

Several cutting-edge technologies show promise for elucidating CrcB2 structure and function:

  • Cryo-Electron Microscopy: Single-particle cryo-EM has revolutionized membrane protein structural biology, enabling determination of near-atomic resolution structures without crystallization. For CrcB2, cryo-EM could reveal the oligomeric state and ion conduction pathway.

  • Microcrystal Electron Diffraction (MicroED): This technique enables structural determination from protein microcrystals too small for traditional X-ray crystallography, potentially overcoming challenges in growing large CrcB2 crystals.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): HDX-MS can map protein dynamics and ligand-binding sites, providing insights into CrcB2 conformational changes during ion transport.

  • Native Mass Spectrometry: This approach can determine the oligomeric state and lipid interactions of purified CrcB2 in near-native conditions.

  • Single-Molecule FRET: By introducing fluorescent labels at strategic positions, conformational changes during CrcB2 function could be monitored in real-time.

How might CRISPR-Cas technology be optimized for genetic manipulation of crcB2 in L. salivarius?

Based on recent characterization of multiple CRISPR-Cas systems in L. salivarius , researchers can develop optimized genetic engineering strategies:

  • System-Specific Guide Design: Tailor guide RNA design to the specific CRISPR-Cas system present in the target L. salivarius strain. Recent research has characterized five different CRISPR-Cas systems (I-B, I-C, I-E, II-A, and III-A) across L. salivarius strains .

  • Self-Targeting Avoidance: Design constructs that avoid sequences matching existing spacers in the native CRISPR arrays to prevent self-targeting and rejection of the introduced DNA.

  • Cas Protein Engineering: Modify native Cas proteins for enhanced specificity or expanded targeting capabilities for precise crcB2 editing.

  • Multi-System Targeting: In strains with multiple CRISPR-Cas systems, design strategies that can evade or utilize each system appropriately.

  • Prophage Induction Consideration: Account for the potential activation of prophages during genetic manipulation, as research has shown that prophages in L. salivarius strains can be induced .

Thoroughly understanding the specific CRISPR-Cas systems present in the target strain is essential for successful genetic manipulation of crcB2 and other genes in L. salivarius.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.