Recombinant Lactococcus lactis subsp. lactis Lipoprotein signal peptidase (lspA) (I65V)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Lactococcus lactis subsp. lactis lipoprotein signal peptidase (lspA) (I65V) is a genetically engineered variant of the lspA enzyme, which plays a critical role in bacterial lipoprotein processing. This enzyme catalyzes the cleavage of signal peptides from prolipoproteins, an essential step in bacterial membrane protein maturation . The I65V mutation (isoleucine to valine substitution at position 65) introduces structural and functional modifications to the enzyme, though its specific biochemical implications require further characterization.

Molecular Architecture

  • Gene: Encoded by the lspA gene (locus LL0997/L0335 in strain IL1403) .

  • Catalytic Activity: Functions as signal peptidase II (EC 3.4.23.36), targeting lipoproteins for membrane anchoring .

Recombinant Expression

  • Host System: Typically expressed in Escherichia coli or L. lactis expression systems .

  • Tags: Includes affinity tags (e.g., His-tag) for purification, though the exact tag varies by production protocol .

Role in Bacterial Physiology

  • Lipoprotein Processing: Essential for virulence in gram-positive bacteria, making lspA a potential antimicrobial target .

  • Nanodisc Integration: The I65V variant has been stabilized in nanodiscs for structural studies, enabling analysis of membrane-protein interactions .

Biotechnological Relevance

  • Probiotic Engineering: L. lactis is widely used for recombinant protein delivery (e.g., HSP65, cytokines) . While lspA itself is not a therapeutic agent, its study informs optimization of secretion systems in engineered strains.

Supplier Data

SupplierLocationProduct CodePurity
CUSABIO TECHNOLOGYChinaCSB-CF875000LNG≥90%

Research Gaps and Future Directions

  • Mechanistic Impact of I65V: No studies directly link this mutation to altered enzymatic activity or stability.

  • Therapeutic Potential: Unlike other L. lactis-expressed proteins (e.g., HSP65 for autoimmune diseases ), lspA (I65V) remains underexplored in clinical contexts.

Product Specs

Buffer
Lyophilized from Tris/PBS-based buffer containing 6% Trehalose.
Form
Available as either liquid or lyophilized powder.
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Typically, we can ship your order within 1-3 working days after receipt. Delivery times may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery information.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 6xHis-tagged
Datasheet & Coa
Please contact us to get it.
Expression Region
1-150aa(I65V)
Mol. Weight
19.9 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Others
Source
in vitro E.coli expression system
Species
Lactococcus lactis
Target Names
lspA
Target Protein Sequence
MKKLLSLVIIVVGIVADQIFKNWIVANIQLGDTEKIWPNVLSLTYIKNDGAAWSSFSGQQWFFLVLTPIVLVVALWFLWKKMAQNWYFIGLTLIIAGALGNFIDRIRQGFVVDMFQTEFINFPIFNIADILLSVGFVLLFIAILTDKETK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: lla:L0335

STRING: 272623.L0335

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.