Recombinant Lactococcus lactis subsp. cremoris Alkaline phosphatase-like protein (apl)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Lactococcus lactis subsp. cremoris Alkaline Phosphatase-Like Protein (Apl) is a 214-amino-acid protein (UniProt ID: Q48630) produced through heterologous expression in Escherichia coli systems . Key molecular features include:

PropertyDetails
Gene nameapl (llmg_1854)
Protein lengthFull-length (1-214 aa)
TagN-terminal His tag
Molecular weight~24 kDa (calculated)
Amino acid sequenceMQEIIIQVMNQFGYFGVAFLIMIEN...VVAILGVIFILGLLLFVKKRFFPKNKNYSPDSEK
Expression hostE. coli

The protein shares homology with alkaline phosphatases but exhibits unique structural adaptations for microbial environments, including transmembrane domains inferred from its hydrophobic sequence .

Expression Systems

While traditionally produced in E. coli , recent advances utilize L. lactis subsp. cremoris for LPS-free production. Key protocols include:

  • Aggregate-based purification: Solubilization of functional protein aggregates (inclusion bodies) using mild detergents, achieving >98.5% purity .

  • Cost-effective workflow: Combines cell lysis, aggregate isolation, and refolding without denaturing agents .

Biochemical Properties

  • Purity: >90% (SDS-PAGE verified) .

  • Activity: Retains phosphatase-like functionality, though substrate specificity remains under investigation .

  • Thermostability: Optimal activity at pH 7–8 and temperatures up to 40°C .

Industrial Relevance

  • Biocatalysis: Potential for phosphate ester hydrolysis in dairy fermentation processes .

  • Bioremediation: Explored for enzymatic degradation of organic phosphates in wastewater .

Immunological Studies

While not directly linked to Apl, L. cremoris strains like YRC3780 demonstrate immunomodulatory effects via dendritic cell-mediated Treg induction . This highlights the broader biotechnological value of L. cremoris-derived proteins.

Advantages Over Conventional Systems

FeatureE. coli-Produced Apl L. lactis-Produced Proteins
LPS contaminationRequires costly removalNaturally LPS-free
Aggregation tendencyHigh (requires refolding)Functional aggregates enable simple recovery
Regulatory complianceLimited by endotoxin concernsGRAS status facilitates food/pharma use

Challenges and Future Directions

  • Functional characterization: Limited data on enzymatic kinetics and physiological substrates.

  • Scale-up optimization: Aggregate-based purification requires standardization for industrial adoption .

  • In vivo studies: Safety and efficacy profiling for potential therapeutic applications .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order notes. We will fulfill your request as best as possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Important: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
apl; llmg_1854; Alkaline phosphatase-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Lactococcus lactis subsp. cremoris (strain MG1363)
Target Names
apl
Target Protein Sequence
MQEIIIQVMNQFGYFGVAFLIMIENIFPPIPSEVILTFGGFMTTYSELGIIGMIIAATIG SVLGALILYFVGRLLSVERLERLVSGRLGKVLRLKPEDITKAEKWFLKRGYATIFFCRFI PLIRSLISVPAGSAKMKLPSFLILTTLGTLIWNIVLVSLGAALGDNWEMIAGILDSYSSV VVAILGVIFILGLLLFVKKRFFPKNKNYSPDSEK
Uniprot No.

Target Background

Database Links
Protein Families
DedA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.