Recombinant Lactococcus lactis subsp. cremoris ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression in Lactococcus lactis

Lactococcus lactis has emerged as an attractive host for the expression of recombinant proteins, including its own atpF protein, due to several advantages:

  1. It is classified as a generally recognized as safe (GRAS) organism

  2. It lacks endotoxins, making it suitable for pharmaceutical applications

  3. It contains few proteases, which enhances protein stability

  4. It can secrete stable recombinant proteins to the growth medium

The P170 expression system is commonly used for recombinant protein production in L. lactis. This system utilizes an inducible promoter (P170) that is upregulated as lactate accumulates in the growth medium. Recent optimization of this expression system has improved promoter strength, signal peptides, and production strains, resulting in enhanced productivity .

Production Methodologies

The production of recombinant atpF protein typically involves the following steps:

  1. Genetic manipulation: The atpF gene is cloned into an appropriate expression vector

  2. Transformation: The recombinant vector is introduced into L. lactis cells

  3. Expression induction: Protein production is triggered by specific inducer molecules

  4. Harvesting and purification: The recombinant protein is extracted and purified

For efficient expression, the nisin-inducible expression system (NICE) has proven effective for membrane proteins like atpF. This system allows controlled expression through the addition of nisin to the culture medium .

Table 1: Comparison of Expression Systems for Recombinant atpF Production

Expression SystemInducerAdvantagesLimitationsYield Range
P170Lactate accumulationSimple batch fermentation, No animal-derived componentsLimited by growth inhibition from lactate0.5-2.5 g/L
NICENisinTightly controlled expression, High protein yieldsRequires careful optimization of induction conditions0.1-1.0 g/L
Gateway-basedVariousSimplified cloning, Versatile for different constructsMore complex setup initially0.1-0.5 g/L

The REED™ technology, which allows control of lactate concentration by electro-dialysis during fermentation, has been successfully combined with the P170 expression system to overcome growth limitations caused by lactate accumulation .

ATP Synthesis and Energy Metabolism

The primary function of ATP synthase, of which atpF is an essential component, is to catalyze the synthesis of ATP from ADP and inorganic phosphate using the energy derived from a transmembrane proton gradient. In L. lactis, this process is particularly important for maintaining cellular energy homeostasis under various environmental conditions .

The ATP synthase complex operates through a rotary mechanism where protons flow through the F0 sector (including the b subunit) down their concentration gradient, driving the rotation of the complex and enabling ATP synthesis at the catalytic sites in the F1 sector. The b subunit serves as a critical stator element that prevents the entire complex from rotating with the rotor components .

Role in Acid Stress Response

One of the most significant functions of the ATP synthase complex in L. lactis is its role in acid stress response and pH homeostasis. L. lactis strains need to maintain their cytoplasmic pH (pHi) within a viable range despite acidification of their environment during fermentation .

Studies have shown that there is a strong correlation between the cellular level of H+-ATPase (which includes the atpF subunit) and cytoplasmic pH. As the environmental pH decreases, the expression of H+-ATPase increases, helping the cell maintain a more neutral internal pH . This relationship is illustrated in Figure 1, which shows H+-ATPase activity levels at different cytoplasmic pH values.

The importance of ATP synthase in acid tolerance is further supported by observations that:

  1. High levels of H+-ATPase coincide with high levels of acid tolerance in batch cultures induced with sublethal levels of acid

  2. Each cytoplasmic pH below 6.6 is characterized by unique levels of acid tolerance response (ATR), H+-ATPase, and ATP

  3. There is an inverse correlation between cytoplasmic ATP levels and cytoplasmic pH

Impact on Membrane Physiology

As a membrane protein, atpF also plays a role in maintaining membrane integrity and function. The expression of membrane proteins like atpF can affect:

Research Tools and Diagnostics

Recombinant atpF protein has been developed into various research and diagnostic tools, including:

  1. ELISA kits for detecting and quantifying atpF in biological samples

  2. Protein standards for structural and functional studies

  3. Immunological reagents for investigating ATP synthase biology

Commercial recombinant atpF products are available with various tags (such as His-tags) for different research applications, with storage recommendations typically including -20°C to -80°C for extended storage and avoidance of repeated freeze-thaw cycles .

Cell Factory Applications

The understanding of atpF biology has contributed to the development of L. lactis as a cell factory for the production of various recombinant proteins. The optimization of ATP metabolism and acid tolerance mechanisms has been crucial for enhancing protein production yields .

Transcriptomic and proteomic studies of recombinant protein production in L. lactis have revealed that:

  1. Overexpression of membrane proteins like atpF can trigger cell envelope stress responses

  2. These stress responses can be harnessed to improve protein folding and processing

  3. Metabolic engineering approaches targeting ATP metabolism can enhance production efficiency

Table 2: Factors Affecting Recombinant atpF Expression and Their Impact

FactorEffect on ExpressionImpact on Cell PhysiologyOptimization Strategy
Growth pHModulates expression levelsAffects acid tolerance and energy metabolismMaintain pH 6.0-6.5 for optimal balance
Growth rateInfluences protein synthesis capacityChanges metabolic patterns and stress responsesControl dilution rate in continuous cultures
Carbon sourceAffects energy available for protein synthesisModifies glycolytic flux and ATP generationSelect appropriate carbon source based on protein complexity
Oxygen levelImpacts respiratory vs. fermentative metabolismChanges ATP yield and redox balanceOptimize aeration for specific protein requirements

Potential Therapeutic Applications

The understanding of atpF biology has opened up potential therapeutic applications:

  1. Development of novel antimicrobial targets, as ATP synthase is essential for bacterial survival

  2. Engineering of L. lactis as a delivery vehicle for vaccines and therapeutic proteins

  3. Utilization in probiotic applications, leveraging the acid tolerance mechanisms

Recent advances include the development of recombinant L. lactis strains expressing antigens from various pathogens, with the atpF-containing ATP synthase complex playing a crucial role in maintaining cell viability under the stress of recombinant protein production .

Current Challenges in Production and Application

Despite the progress in recombinant atpF production and application, several challenges remain:

  1. Membrane protein expression often yields lower amounts compared to soluble proteins

  2. The complex structure of ATP synthase makes functional reconstitution challenging

  3. Maintaining proper folding and assembly of the recombinant protein requires careful optimization

  4. Scaling up production for industrial applications presents technical hurdles

Emerging Research Directions

Current research is focusing on several promising directions:

  1. Integration of systems biology approaches to further optimize expression conditions

  2. Development of novel genetic tools for precise control of atpF expression

  3. Exploration of structure-function relationships to engineer proteins with enhanced properties

  4. Application of synthetic biology principles to create novel ATP synthase variants

The manipulation of ATP-binding cassette (ABC) transporters has shown promise for enhancing acid stress tolerance in L. lactis, with studies demonstrating that overexpression of specific ABC transporters increased intracellular ATP concentrations to protect cells against acidic damage . This research direction could potentially be applied to optimize atpF expression and function.

Future Applications

The future of recombinant atpF research and applications may include:

  1. Development of engineered L. lactis strains with enhanced ATP production capabilities

  2. Creation of synthetic ATP synthase complexes with novel properties

  3. Application in bioenergy production systems

  4. Integration into biosensors and bioelectronic devices

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; LACR_1937; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Lactococcus lactis subsp. cremoris (strain SK11)
Target Names
atpF
Target Protein Sequence
MSTLLLEAAPNTVLGNIIVVSGAFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEAN NKQAADLVKQRQAELAGSKEEAANIIQVANDTASQNRAKVLATANEEATSLKKRAQEDIE QERKEALNTVKGDVADISVQIAEKLIGQSLDASAQQELIDSYLAKLGE
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core; and the F0 domain, containing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the function of ATP synthase subunit b (atpF) in Lactococcus lactis?

ATP synthase subunit b (atpF) is an integral component of the F₀F₁-ATP synthase complex in Lactococcus lactis. This membrane-bound protein forms part of the stator stalk that connects the F₁ catalytic domain to the membrane-embedded F₀ domain. The subunit b plays a crucial role in maintaining the structural integrity of the ATP synthase complex and facilitating the energy coupling mechanism between proton translocation and ATP synthesis.

In Lactococcus lactis, ATP synthesis is particularly important as these bacteria rely heavily on substrate-level phosphorylation for energy generation, especially during homolactic and mixed-acid fermentation pathways . The ATP synthase complex is integral to energy metabolism, contributing to the maintenance of intracellular ATP levels that support various cellular processes.

How does the ATP synthase complex contribute to energy metabolism in Lactococcus lactis?

The ATP synthase complex in Lactococcus lactis plays a fundamental role in cellular bioenergetics, particularly in relation to fermentation pathways. Unlike aerobic organisms that primarily use oxidative phosphorylation, L. lactis generates ATP through substrate-level phosphorylation during fermentation. The specific rate of substrate-level ATP synthesis (qATP) is stoichiometrically coupled to the rate of fermentation products, particularly lactate, acetate, and ethanol .

The ATP synthase complex functions differently depending on growth conditions and metabolic demands. Under homolactic fermentation, L. lactis produces two ATP molecules per glucose molecule, while under mixed-acid fermentation, it can generate three ATP molecules per glucose . This flexibility in energy metabolism allows L. lactis to adapt to different environmental conditions, such as pH changes and nutrient availability.

What is the relationship between ATP synthase and pH adaptation in Lactococcus lactis?

Lactococcus lactis demonstrates remarkable adaptation to varying pH environments, with ATP synthase playing a significant role in this process. Research has shown that L. lactis exhibits different ATP yields (YATP) at different pH values, with the highest YATP corresponding to the pH of its natural habitat . This indicates that ATP synthase function is optimized for the specific environmental conditions where the organism naturally thrives.

The pH-dependent changes in ATP production efficiency suggest that the ATP synthase complex, including the atpF subunit, may undergo structural or functional modifications in response to environmental pH. These adaptations likely contribute to the organism's ability to maintain energy homeostasis across a range of conditions, supporting its ecological versatility.

What methods are most effective for overexpressing ATP synthase subunit b in Lactococcus lactis?

For efficient overexpression of ATP synthase subunit b in Lactococcus lactis, researchers should consider a strategy that accounts for membrane protein quality control mechanisms. The CesSR two-component system has been identified as a major player in membrane protein overproduction in L. lactis . This system senses cell envelope stresses that arise during membrane protein production.

Methodology for optimal expression:

This approach has been successfully applied to improve production yields of various membrane proteins, including eukaryotic proteins that are typically challenging to express in bacterial systems .

How does the CesSR two-component system influence membrane protein expression in Lactococcus lactis?

The CesSR two-component system functions as a central membrane protein quality control mechanism in Lactococcus lactis. Transcriptome analysis has revealed that CesSR is significantly upregulated during membrane protein overproduction, particularly when expressing proteins like BcaP, a branched-chain amino acid permease .

CesSR monitors cell envelope integrity and activates a specific stress response when membrane protein overproduction causes cellular stress. This response involves the regulation of several genes that facilitate membrane protein production, including:

  • ftsH: Encodes a membrane-bound ATP-dependent protease involved in protein quality control

  • oxaA2: Involved in membrane protein insertion

  • llmg_2163: Function not fully characterized but important for membrane protein production

  • rmaB: A transcriptional regulator

Knockout studies have demonstrated that disruption of the CesSR system or its regulon members severely hampers growth and membrane protein production capabilities in L. lactis . Conversely, strategic overexpression of cesSR can reduce growth defects associated with membrane protein overproduction and significantly improve production yields, in some cases by more than 4-fold .

This system appears to be universally important for membrane protein production in L. lactis, making it a valuable target for strain engineering efforts aimed at improving recombinant protein yields, including ATP synthase components.

What is the impact of growth rate on ATP production and energy metabolism in Lactococcus lactis?

Growth rate significantly impacts ATP production and energy metabolism in Lactococcus lactis, with distinct metabolic shifts occurring at different dilution rates in continuous culture. Research has shown that during glucose-limited continuous growth, L. lactis can switch from homolactic to mixed acid fermentation depending on growth rate .

The relationship between growth rate and metabolism is characterized by:

  • At lower dilution rates (e.g., 0.05 h⁻¹), L. lactis tends to produce more mixed acid fermentation products (formate, acetate, ethanol), which yields more ATP per glucose molecule (3 ATP vs. 2 ATP in homolactic fermentation) .

  • At higher dilution rates (e.g., 0.15 h⁻¹), homolactic fermentation becomes predominant, with lactate as the major end product .

  • The ATP demand increases linearly with growth rate, but the efficiency of ATP utilization (YATP) varies with conditions.

This metabolic flexibility allows L. lactis to optimize energy production based on growth conditions. The ATP synthase complex, including the atpF subunit, plays a critical role in maintaining ATP homeostasis across these varying growth conditions.

How do genetic modifications of energy metabolism pathways affect ATP synthase function?

In ldh deletion strains of L. lactis, the organism shifts from homolactic fermentation to mixed acid fermentation, producing more formate, acetate, and ethanol instead of lactate . This metabolic shift changes the stoichiometry of ATP production, potentially affecting the demands on ATP synthase.

Interestingly, deletion of ldh genes had minimal impact on growth rates in chemically defined medium under microaerophilic conditions but showed more significant effects in rich medium . This suggests that the relationship between primary metabolism and ATP synthase function is context-dependent, influenced by nutritional availability and environmental conditions.

The specific ATP synthesis rates and ATP yields (YATP) also change in response to genetic modifications. These changes reflect adjustments in the efficiency of energy utilization and production, highlighting the adaptive mechanisms that L. lactis employs to maintain energy homeostasis even when key metabolic pathways are disrupted.

What expression systems are most suitable for producing recombinant ATP synthase subunit b?

For optimal production of recombinant ATP synthase subunit b from Lactococcus lactis, several expression systems can be considered, each with specific advantages:

Expression SystemHost OrganismKey FeaturesBest Applications
NICE SystemL. lactis- Nisin-inducible expression
- Tight regulation
- Suitable for membrane proteins
- High-yield production
- Functional studies
CesSR-enhanced SystemL. lactis- Co-expression with CesSR
- Reduced cell envelope stress
- Higher yields for difficult proteins
- Challenging membrane proteins
- Structural studies requiring high purity
E. coli-based SystemsE. coli- Well-established protocols
- Various fusion tags available
- Higher biomass production
- Initial screening
- Prototype expression testing

The L. lactis-based expression systems are particularly advantageous for ATP synthase subunit b production because:

  • L. lactis has been demonstrated as a legitimate alternative host for membrane protein production .

  • The CesSR system in L. lactis provides a specialized membrane protein quality control mechanism that can be modulated to improve production yields .

  • L. lactis has simpler cell envelope structure compared to gram-negative bacteria, potentially facilitating extraction and purification.

  • Expression in the native organism increases the likelihood of proper folding and assembly.

For best results, consider implementing a strain engineering approach that leverages the CesSR two-component system regulation, as this has been shown to significantly improve membrane protein production yields .

How can I optimize culture conditions to maximize ATP synthase subunit b expression?

Optimizing culture conditions is critical for maximizing the expression of ATP synthase subunit b in Lactococcus lactis. Based on research with similar membrane proteins, the following parameters should be carefully controlled:

  • Media composition:

    • Chemically defined medium (CDM-LAB) has shown better results for membrane protein expression compared to rich media like THY medium .

    • Carbon source availability significantly impacts metabolism and protein expression. Glucose is typically used, but the ability to utilize different substrates may be affected by genetic modifications .

  • pH control:

    • Maintain pH between 6.5-7.5, as this range has shown optimal results for membrane protein expression in L. lactis .

    • Consider that the optimal pH for protein production may correspond to the pH of the organism's natural habitat, which affects ATP yield (YATP) .

  • Growth conditions:

    • Microaerophilic conditions are typically preferred for L. lactis cultivation .

    • For continuous cultures, lower dilution rates (e.g., 0.05 h⁻¹) may favor mixed acid fermentation and potentially different protein expression patterns than higher rates (0.15 h⁻¹) .

  • Induction parameters:

    • When using inducible expression systems, optimize inducer concentration and timing.

    • Consider that membrane protein overproduction triggers stress responses, so balanced expression is crucial .

  • Harvest timing:

    • Monitor growth to ensure harvest occurs at steady state, when culture parameters (ODs, dry weights, product concentrations) remain constant .

By carefully optimizing these parameters and potentially implementing a CesSR co-expression strategy, the production yield of ATP synthase subunit b can be significantly improved.

What analytical methods are most effective for characterizing ATP synthase subunit b function?

Characterizing the function of ATP synthase subunit b requires a combination of biochemical, biophysical, and genetic approaches. The following analytical methods are particularly effective:

  • ATP synthesis/hydrolysis assays:

    • Measure ATP production rates using luciferase-based assays or HPLC analysis.

    • Quantify inorganic phosphate release to assess ATPase activity.

    • Compare wild-type and modified variants to assess functional impact of specific residues or domains.

  • Membrane potential measurements:

    • Use fluorescent probes (e.g., DiSC3(5)) to monitor membrane potential changes associated with ATP synthase activity.

    • Correlate proton translocation with ATP synthesis/hydrolysis rates.

  • Protein-protein interaction studies:

    • Implement crosslinking techniques to identify interaction partners within the ATP synthase complex.

    • Use pull-down assays with tagged atpF to isolate and identify associated components.

    • Apply fluorescence resonance energy transfer (FRET) approaches for in vivo interaction studies.

  • Structural analysis:

    • Employ circular dichroism (CD) spectroscopy to assess secondary structure.

    • Use limited proteolysis combined with mass spectrometry to identify structured domains.

    • For high-resolution studies, pursue X-ray crystallography or cryo-electron microscopy of the purified complex.

  • Genetic complementation:

    • Generate atpF deletion strains and assess phenotypic changes in growth, pH tolerance, and metabolic profiles.

    • Perform complementation studies with modified atpF variants to correlate structure with function.

  • Metabolic flux analysis:

    • Implement methods similar to those used for analyzing carbon fluxes in related studies .

    • Use HPLC to determine concentrations of key metabolites including glucose, pyruvate, lactate, formate, acetate, succinate, and ethanol .

    • Calculate specific ATP synthesis rates based on metabolite measurements .

How can I troubleshoot poor expression of ATP synthase subunit b in recombinant systems?

Poor expression of ATP synthase subunit b is a common challenge in recombinant systems. Based on research with membrane proteins in Lactococcus lactis, the following troubleshooting strategies are recommended:

  • Address cell envelope stress:

    • Co-express the CesSR two-component system, which has been shown to significantly improve membrane protein production by managing cell envelope stress .

    • Consider that deletion of stress-response genes like ftsH, oxaA2, llmg_2163, and rmaB severely hampers growth and membrane protein production .

  • Optimize expression construct:

    • Evaluate codon usage and optimize if necessary for the expression host.

    • Test different fusion tags that may improve folding or reduce toxicity.

    • Consider using a weaker promoter or an inducible system with fine-tuned expression levels.

  • Adjust growth conditions:

    • Compare expression in defined media (CDM-LAB) versus rich media (THY) under different pH conditions (6.5 vs. 7.5) .

    • Optimize temperature, as lower temperatures may reduce protein aggregation and improve folding.

    • Adjust aeration levels, as microaerophilic conditions are often optimal for L. lactis .

  • Implement strain engineering:

    • Select host strains with enhanced capabilities for membrane protein production.

    • Consider that wild-type and ldh deletion strains show different growth characteristics depending on media composition and pH .

  • Evaluate protein stability:

    • Add protease inhibitors during extraction to prevent degradation.

    • Test protein expression at different time points after induction to identify optimal harvest time.

By systematically addressing these aspects, researchers can significantly improve the expression of challenging membrane proteins like ATP synthase subunit b, potentially achieving the 4-fold or greater improvement in yields observed with other membrane proteins when implementing CesSR co-expression strategies .

What are the best approaches for studying interactions between ATP synthase subunits?

Studying interactions between ATP synthase subunit b and other components of the ATP synthase complex requires specialized techniques that preserve the native structure and function of these membrane-associated proteins:

  • In vivo crosslinking:

    • Use membrane-permeable crosslinkers to capture interactions in their native cellular environment.

    • Implement site-specific crosslinking by incorporating photo-activatable amino acids at strategic positions within the atpF sequence.

    • Analyze crosslinked products using mass spectrometry to identify interaction partners and contact sites.

  • Co-immunoprecipitation strategies:

    • Engineer epitope tags (His6, FLAG, etc.) on atpF that minimally disrupt function .

    • Use tagged variants to pull down interacting partners under mild solubilization conditions.

    • Verify interactions using western blotting with antibodies against known ATP synthase components.

  • Genetic approaches:

    • Employ bacterial two-hybrid systems adapted for membrane protein interactions.

    • Create suppressor mutation screens to identify residues that compensate for defects in atpF mutations.

    • Use fluorescently labeled subunits (similar to BcaP-GFP-H6) to monitor complex assembly and localization.

  • Biophysical methods:

    • Implement Förster resonance energy transfer (FRET) between fluorescently labeled subunits to measure distances and conformational changes.

    • Use surface plasmon resonance (SPR) with purified components to determine binding kinetics.

    • Apply native mass spectrometry to analyze intact ATP synthase subcomplexes.

  • Computational approaches:

    • Perform molecular docking simulations based on available structural data.

    • Use coevolution analysis to predict interacting residues between subunits.

    • Implement molecular dynamics simulations to understand the dynamics of subunit interactions.

By combining multiple approaches, researchers can build a comprehensive understanding of how ATP synthase subunit b interacts with other components of the complex and how these interactions contribute to the function of ATP synthase in Lactococcus lactis.

How does ATP synthase contribute to stress adaptation in Lactococcus lactis?

ATP synthase plays a crucial role in stress adaptation mechanisms in Lactococcus lactis, particularly in response to environmental challenges such as pH fluctuations, nutrient limitations, and oxidative stress:

  • pH stress adaptation:

    • L. lactis shows pH-dependent changes in ATP yield (YATP), with optimal efficiency at pH values corresponding to the organism's natural habitat .

    • ATP synthase may undergo functional modifications at different pH values to maintain energy homeostasis, suggesting a role in acid stress response.

  • Metabolic flexibility:

    • Under glucose limitation in continuous culture, L. lactis switches from homolactic to mixed acid fermentation, which alters ATP production stoichiometry .

    • This metabolic shift, which changes ATP production efficiency, is growth rate-dependent in S. pyogenes and pH-dependent in E. faecalis, suggesting distinct regulatory mechanisms across lactic acid bacteria .

  • Integration with stress response systems:

    • The CesSR two-component system, which responds to cell envelope stress, appears to coordinate with energy metabolism during stress conditions .

    • Deletion of CesSR regulon members affects growth and protein production capabilities, suggesting a link between energy metabolism and stress response mechanisms .

  • Comparative stress responses:

    • Despite similar primary metabolism across lactic acid bacteria (L. lactis, E. faecalis, S. pyogenes), these organisms persist in completely different environments (milk, feces, skin/mucous membranes) .

    • ATP synthase function may be optimized for these distinct ecological niches, contributing to the organism's ability to adapt to specific environmental conditions.

What is the potential for ATP synthase modifications to improve industrially relevant strains of Lactococcus lactis?

ATP synthase modifications offer significant potential for improving industrially relevant strains of Lactococcus lactis, particularly for applications in biotechnology, food production, and recombinant protein manufacturing:

  • Enhanced energy efficiency:

    • Optimizing ATP synthase function could improve energy utilization efficiency, potentially increasing biomass yield and reducing fermentation costs.

    • Targeted modifications of ATP synthase subunits, including atpF, might enhance ATP production under specific industrial conditions.

  • Improved stress tolerance:

    • Modified ATP synthase variants could confer greater resistance to industrial stressors such as temperature fluctuations, pH changes, and high product concentrations.

    • Coupling ATP synthase modifications with stress response systems like CesSR could create more robust production strains .

  • Recombinant protein production enhancements:

    • Optimized energy metabolism could support higher yields of recombinant proteins, including difficult-to-express membrane proteins.

    • The experiences with improving membrane protein production through CesSR modulation could be extended to optimize ATP synthase function for industrial applications .

  • Metabolic engineering applications:

    • ATP synthase modifications could be integrated with broader metabolic engineering strategies to redirect carbon flux toward desired products.

    • Similar to how ldh deletion affects carbon flux distribution , strategic ATP synthase modifications might influence fermentation profiles for specialty chemical production.

  • Production host improvements:

    • Rational engineering of L. lactis as a production host, incorporating optimized ATP synthase variants, could establish it as a more widely used alternative to traditional production organisms .

    • The natural GRAS (Generally Recognized As Safe) status of L. lactis makes it particularly attractive for food and pharmaceutical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.