Recombinant Lactococcus lactis subsp. cremoris Biotin transporter BioY (bioY)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Lactococcus lactis subsp. cremoris Biotin Transporter BioY (BioY)

Recombinant Lactococcus lactis subsp. cremoris BioY is a recombinant protein derived from the bioY gene, which encodes a biotin-specific transporter belonging to the Energy-Coupling Factor (ECF) transporter family. It functions as a substrate-binding component (S unit) in bacterial biotin uptake systems. Unlike most ECF transporters that require auxiliary T and ATPase units, solitary BioY proteins can independently mediate biotin transport in certain organisms .

Functional Role in Biotin Transport

BioY binds biotin with high affinity (dissociation constant K<sub>d</sub> ~300 pM in L. lactis) and facilitates its transmembrane transport. Key findings:

  • In Vivo Activity: Solitary BioY proteins from L. lactis and other proteobacteria enable biotin uptake in E. coli auxotrophs lacking endogenous transporters .

  • In Vitro Controversy: Purified BioY from L. lactis (LlBioY) binds biotin but shows no transport activity in proteoliposomes, suggesting potential dependency on in vivo conditions .

Expression and Production

BioY is primarily expressed in E. coli for recombinant production due to challenges in native L. lactis systems:

ParameterDetails
HostE. coli
PlasmidpPimA or pSIM6 for auxotrophy complementation
Purity≥85% by SDS-PAGE
Yield ChallengesLimited BCAA uptake in L. lactis strains may restrict native expression

Research Findings and Implications

  • Functional Discrepancy: BioY’s transport activity in vivo contradicts in vitro results, highlighting the need for cellular context in transporter studies .

  • Evolutionary Diversity: Solitary BioY proteins in L. lactis and Chlamydia spp. suggest convergent evolution for biotin acquisition .

  • Biotechnological Potential: BioY’s recombinant form enables strain engineering for enhanced biotin metabolism in industrial microbes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
bioY; llmg_1964; Biotin transporter BioY; Biotin ECF transporter S component BioY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Lactococcus lactis subsp. cremoris (strain MG1363)
Target Names
bioY
Target Protein Sequence
MTNNQKVKTLTYSAFMTAFIIILGFLPGIPIGFIPVPIILQNMGIMMAGGLLGPKYGTIS VGAFLALALIGLPVLTGGNGGAASFLGPSGGYRIAWLFTPFLIGFFLKKLKITTSQNWFG ELIIVLLFGVIFVDFVGAIWLSFQSNIPLLTSLISNLVFIPGDCIKAILTVVIVRRLRKQ GGFELYFRK
Uniprot No.

Target Background

Function
BioY is likely a biotin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike typical ABC transporters, this ECF transporter provides the energy required for the transport of a variety of substrates. The substrates themselves are bound by transmembrane proteins rather than extracytoplasmic soluble proteins.
Database Links
Protein Families
BioY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biotin transport system in L. lactis and why is it significant for research?

The biotin transport system in Lactococcus lactis is particularly significant as this organism appears to be auxotrophic for biotin, lacking a complete biotin biosynthesis pathway . Unlike Escherichia coli which possesses both biosynthetic capabilities and transport mechanisms, L. lactis relies primarily on biotin scavenging through specialized transport systems, with BioY being a key component. The BioY protein functions as a high-affinity S-component of the Energy-Coupling Factor (ECF) transporter family dedicated to biotin uptake.

Research significance stems from several factors:

  • BioY represents an essential nutrient acquisition system in a biotin-auxotrophic organism

  • L. lactis demonstrates a unique biotin scavenging pathway with apparent genetic redundancy

  • Understanding biotin transport mechanisms provides insights into probiotic metabolism

  • BioY transporter systems offer potential applications in metabolic engineering and strain improvement

How does biotin requirement affect L. lactis growth and metabolism?

Biotin functions as an essential cofactor for carboxylase enzymes involved in fatty acid synthesis, amino acid metabolism, and gluconeogenesis. In L. lactis, biotin limitation results in:

  • Reduced growth rates and biomass production

  • Altered membrane lipid composition

  • Metabolic shifts affecting central carbon metabolism

  • Changes in expression of biotin-dependent carboxylases

Since L. lactis appears to be auxotrophic for biotin , efficient biotin transport via systems like BioY becomes critical for maintaining cellular viability and metabolic homeostasis, particularly in biotin-limited environments.

What is the genomic organization of biotin transport genes in L. lactis subsp. cremoris?

The biotin transport system in L. lactis subsp. cremoris involves several components with interesting organizational features:

  • The bioY gene typically encodes the S-component of the ECF transport system

  • Unlike E. coli with a single biotin protein ligase (BPL) gene (birA), L. lactis possesses two different orthologues of birA (birA1_LL and birA2_LL)

  • This redundancy suggests evolutionary adaptation to biotin-limited environments

  • Genomic context analysis reveals potential regulatory elements including biotin-responsive elements (BREs)

The presence of duplicate biotin-related genes indicates a sophisticated regulatory network for biotin uptake and utilization, suggesting that BioY may be part of a larger, coordinated system for biotin homeostasis.

How does the expression of bioY compare between different L. lactis strains?

Expression patterns of bioY vary significantly between L. lactis strains and under different growth conditions:

L. lactis StrainRelative bioY ExpressionGrowth MediumNotes
IL1403 (wild type)1.0 (baseline)M17G, pH 7.0Reference condition
IL1403 with pBV1530.9-1.1M17G, pH 7.0Control with empty vector
IL1403 with pIQ1012.3-2.8M17G, pH 5.5Under acid stress
Deletion mutant (ΔgdpP)1.5-1.8M17G, pH 7.0Modified cyclic nucleotide signaling

The expression of bioY appears to be responsive to environmental conditions, particularly medium pH and nutrient availability. Genetic background also influences expression levels, with strain-specific variations potentially reflecting adaptation to different ecological niches .

What expression systems are most effective for studying recombinant BioY in L. lactis?

Several expression systems have proven effective for studying recombinant BioY in L. lactis, each with distinct advantages:

  • NICE System (Nisin-Controlled Expression):

    • Allows tight regulation of bioY expression through nisin induction

    • Demonstrated effectiveness in L. lactis for heterologous protein expression

    • Example: pNZ8048-derived vectors provide controllable expression levels

  • pH-Controlled Expression Systems:

    • The pBV153 vector with Pcit promoter enables pH-regulated gene expression

    • Particularly valuable for mimicking gastrointestinal transit conditions

    • Expression can be modulated by changing medium pH from 7.0 to 5.5

  • Constitutive Expression Systems:

    • P45 and P32 promoters provide stable, constitutive expression

    • Useful for complementation studies and long-term experiments

For optimal results, the choice of expression system should match experimental objectives. The NICE system provides precise control for biochemical characterization, while pH-controlled systems may better represent physiological conditions.

What methods are most effective for measuring BioY transport activity?

Measuring BioY transport activity requires specialized techniques that address the challenges of working with membrane proteins:

  • Radioactive Biotin Uptake Assays:

    • Using [³H]-biotin or [¹⁴C]-biotin to measure transport kinetics

    • Protocol involves:

      • Growing cells to mid-log phase (OD₆₀₀ = 0.4-0.6)

      • Washing cells in transport buffer (50 mM HEPES, 50 mM NaCl, pH 7.0)

      • Incubating with labeled biotin (1-1000 nM range)

      • Filtering cells and measuring cell-associated radioactivity

  • Fluorescent Biotin Analogs:

    • FITC-biotin or streptavidin-conjugated fluorophores

    • Allows real-time visualization of transport in live cells

    • Less disruptive than radioactive methods but may alter transport kinetics

  • Growth-Based Complementation Assays:

    • Using biotin auxotrophic strains with recombinant bioY

    • Measuring growth restoration in biotin-limited media

    • Provides functional evidence in a physiological context

When analyzing results, researchers should account for non-specific binding and passive diffusion by using appropriate controls, including competition with excess unlabeled biotin.

How can CRISPR-Cas9 be optimized for bioY modifications in L. lactis?

CRISPR-Cas9 technology has revolutionized genetic engineering in lactic acid bacteria. For bioY modifications in L. lactis, consider the following optimization strategies:

  • sgRNA Design Considerations:

    • Target sequences with NGG PAM sites

    • Avoid regions with secondary structure

    • Select guides with minimal off-target potential

    • Test multiple guides targeting different regions of bioY

  • Delivery Methods:

    • Two-plasmid system: one carrying Cas9, another with sgRNA and repair template

    • Temperature-sensitive vectors for transient expression

    • Electroporation parameters: 25 μF, 200 Ω, 2.5 kV/cm for L. lactis

  • Screening Protocols:

    • PCR verification of modifications using primers flanking the target site

    • Restriction digest screening if modification introduces/removes sites

    • Biotin-dependent growth phenotyping for functional validation

  • Efficiency Improvements:

    • Include anti-CRISPR proteins to reduce toxicity

    • Optimize homology arm length (500-1000 bp) for repair templates

    • Use counter-selection markers for enrichment of modified cells

This approach allows for precise modifications including point mutations, deletions, or insertions within the bioY gene, enabling structure-function studies and regulatory analysis.

What strategies can optimize BioY overexpression for functional studies?

Optimizing BioY overexpression in L. lactis requires addressing several challenges common to membrane protein expression:

  • Codon Optimization:

    • Adjust codon usage to match L. lactis preferences

    • Avoid rare codons that may limit translation efficiency

    • Remove potential regulatory sequences or internal RBS

  • Expression Tuning:

    • Use inducible promoters with variable induction levels

    • The nisin-inducible system allows titration of expression levels

    • Test multiple ribosome binding site strengths

    • Consider dual-plasmid systems for complex experiments

  • Host Strain Selection:

    • NZ9000 strain (MG1363 derivative) works well with NICE system

    • Consider ΔgdpP strains with altered cyclic-di-AMP metabolism for improved membrane protein expression

    • Evaluate IL1403-derived strains for alternative expression characteristics

  • Growth Conditions:

    • Lower growth temperature (25-28°C instead of 30°C)

    • Adjust media composition (glycine addition for cell wall weakening)

    • Control pH between 6.5-7.0 for optimal expression

  • Extraction Optimization:

    • Gentle cell disruption methods (lysozyme treatment followed by French press)

    • Detergent screening for optimal BioY solubilization

    • Affinity tag position optimization (C-terminal tags often work better)

These strategies have proven successful for other membrane proteins in L. lactis and can be adapted specifically for BioY studies.

How does cyclic-di-AMP signaling affect biotin transport in L. lactis?

Recent research suggests fascinating connections between cyclic-di-AMP signaling and biotin transport:

  • Regulatory Interactions:

    • Cyclic-di-AMP levels influence membrane homeostasis and transport systems

    • L. lactis strains with elevated c-di-AMP levels (ΔgdpP or cdaA overexpression) show altered transport patterns

    • Growth phenotypes in high c-di-AMP strains include hypersensitivity to salt and cell wall stressors

  • Experimental Evidence:

    • The LL1 strain (with increased c-di-AMP levels) shows approximately 19-fold higher c-di-AMP concentration compared to wild type under acidic conditions

    • This corresponds with changes in membrane permeability and transporter function

    • Potential direct or indirect regulation of biotin transport via c-di-AMP signaling pathways

  • Mechanistic Hypotheses:

    • c-di-AMP may regulate bioY expression via transcriptional or post-transcriptional mechanisms

    • Altered membrane potential in high c-di-AMP strains could affect energy coupling to transport systems

    • Potential interactions between c-di-AMP binding proteins and components of biotin transport machinery

This emerging area represents an exciting frontier in understanding the integration of bacterial second messenger signaling with nutrient acquisition systems.

How can BioY transport function be integrated with immunomodulatory applications?

The intersection of biotin transport and immunomodulation presents intriguing research opportunities:

  • Dual-Function Recombinant Strains:

    • L. lactis can be engineered to combine biotin transport optimization with immunomodulatory functions

    • Similar to approaches used for c-di-AMP production and antigen expression

    • Biotin-optimized strains may serve as more robust delivery vehicles for immunomodulatory molecules

  • Relevance to Dendritic Cell Interactions:

    • L. lactis strains interact with intestinal dendritic cells (DCs), influencing immune responses

    • Biotin availability may affect bacterial persistence and DC interaction dynamics

    • BioY-optimized strains could show enhanced survival in the gastrointestinal environment

  • Experimental Design Considerations:

    • Co-culture systems with DCs can evaluate immunomodulatory effects

    • Flow cytometry assessment of DC maturation markers after exposure to BioY-modified strains

    • Cytokine profiling to assess immunomodulatory impact

    • In vivo tracking of biotin-optimized strains through the GI tract

This approach represents a sophisticated application of biotin transport research that bridges metabolic engineering and immunomodulation for potential therapeutic applications.

What are common pitfalls in BioY functional assays and how can they be addressed?

Researchers frequently encounter these challenges when conducting BioY functional assays:

  • Background Biotin Contamination:

    • Many media components contain trace biotin that confounds transport assays

    • Solution: Use biotin-depleted media (treat with streptavidin-agarose) and dialyzed serum

  • Membrane Protein Instability:

    • BioY may denature during isolation and reconstitution procedures

    • Solution: Optimize detergents (mild options like DDM or LMNG) and maintain strict temperature control

  • Variable Expression Levels:

    • Inconsistent BioY expression between experiments affects reproducibility

    • Solution: Quantify protein levels via Western blot with anti-tag antibodies for normalization

  • Non-specific Binding:

    • Biotin binds non-specifically to cell surfaces, confounding uptake measurements

    • Solution: Include parallel measurements at 4°C to quantify non-specific binding

  • Energy Coupling Inconsistency:

    • ECF transporters require proper energetic coupling that may be disrupted

    • Solution: Verify membrane potential maintenance with appropriate indicators

Implementing these solutions significantly improves assay reliability and facilitates meaningful comparisons between experimental conditions.

How should researchers interpret contradictory data regarding BioY function?

When facing contradictory results in BioY research, consider this systematic approach:

  • Methodological Differences Analysis:

    • Compare experimental conditions in detail (media composition, growth phase, pH)

    • Assess protein expression levels and localization between contradictory studies

    • Evaluate the impact of different tags and fusion partners on BioY function

  • Strain-Specific Variations:

    • Different L. lactis strains may have distinct biotin transport characteristics

    • Sequence BioY and associated transporters to identify strain-specific polymorphisms

    • Consider regulatory differences between laboratory strains

  • Interactions with Other Transport Systems:

    • Redundant biotin transport mechanisms may compensate for BioY dysfunction

    • Test for upregulation of alternative transporters in BioY-deficient strains

    • Consider the impact of the presence of two different BirA orthologues in L. lactis

  • Resolution Strategies:

    • Direct comparison experiments under identical conditions

    • Collaborative cross-validation between laboratories

    • Complementary approaches combining in vitro and in vivo methods

This structured approach helps resolve apparent contradictions and advances understanding of the nuanced aspects of biotin transport in L. lactis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.