Recombinant Lactococcus lactis subsp. cremoris DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

DNA Translocation and KOPS Recognition

  • FtsK binds KOPS motifs (e.g., L. lactis-specific 5′-GAAGAAG-3′) to direct DNA movement toward the chromosomal terminus (dif site) .

  • ATP-dependent translocation resolves chromosomal catenanes and activates site-specific recombinases (XerS) for dimer resolution .

Role in Cell Division

  • Localizes at the division septum to coordinate chromosome segregation with cytokinesis .

  • In D. radiodurans, FtsK upregulation post-irradiation facilitates genome repair by resolving DNA multimers .

Chromosome Segregation Studies

  • Mechanistic Insights: Single-molecule assays reveal FtsK’s ability to displace DNA-bound proteins during translocation .

  • KOPS Motif Variation: Comparative studies in Streptococcaceae show FtsK adapts to A-rich KOPS motifs in low-GC genomes .

Xer Recombination Activation

  • FtsK’s C-terminal domain (FtsKC) stimulates XerS-mediated recombination at difSL sites, resolving chromosome dimers in L. lactis .

  • In E. coli, heterologous FtsK from L. lactis fully supports dimer resolution, highlighting functional conservation .

Industrial and Evolutionary Relevance

  • Serves as a model for studying divisome machinery in non-rod-shaped bacteria .

  • Engineered FtsK variants help dissect ATPase regulation and DNA interaction dynamics .

Comparative Analysis of KOPS Motifs

OrganismKOPS MotifFunction
E. coli5′-GGGNAGGG-3′Orients FtsK toward dif
Bacillus subtilis5′-GGGGAGGG-3′Guides SftA/FtsK translocation
L. lactis5′-GAAGAAG-3′A-rich motif for FtsK directionality

Challenges and Future Directions

  • Structural Dynamics: High-resolution studies are needed to elucidate conformational changes during ATP hydrolysis .

  • Biotechnological Adaptations: Engineering FtsK for synthetic genome segregation systems in industrial Lactococcus strains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ftsK; llmg_0766; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-755
Protein Length
full length protein
Species
Lactococcus lactis subsp. cremoris (strain MG1363)
Target Names
ftsK
Target Protein Sequence
MPAKKKTTRRNTKKELQKKAATRKMIAFFVGLLLILFALARLGIVGILLYNIVRLFIGSL AIILLLLVAAIMILSVFRKQFLKENKRIIPAIILTFIGLMFVFQIRLHQGLNETFHLIWS DLTAGRVIHFVGSGLIGAIITEPAKALFSVIGVYIIAAVLWLVAIYLMIPGLFPKMREDL HQRLAKWKEKRAEKVEAKKAVKALKKLEEEKEIPEPQTILPEAENSLFTSAPVEIPINIP EAPFEENENPVLEENPVDDEPVNFMNTNNYNGNYKLPTIDLLAEVPVKNQSGERENVRKN IGILEETFKSFGIGANVESAVVGPSITKYEIKLATGTKVSRVVNLSDDLALALAAKDIRI EAPIPGKSLVGVEIPNAEVAMVGFREMWEAGKTNPSKLLEIPLGKSLDGGIRTFDLTRMP HLLVAGSTGSGKSVAVNGIITSILMKALPSQVKFLMVDPKMVELSVYNDIPHLLIPVVTN PRKASRALQKVVDQMEERYELFSRYGVRNIAGYNEKVQRYNAESDEKMLELPLIVVIVDE LADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVDVISGLIKANVPSRIAFAVSS GTDSRTILDTNGAEKLLGRGDMLFKPIDENHPVRLQGAFLSDDDVEAVVTFIKDQSEAQY DESFDPGEVDENQVGTGASNTGSGDPLFEEARNMVIIAQKASTAQLQRALKVGFNRASDL MNELEAQGIVGPAKGTTPRKVLVSPDGEFIGGVEE
Uniprot No.

Target Background

Function
FtsK, an essential cell division protein, coordinates cell division and chromosome segregation. Its N-terminus participates in cell division machinery assembly. The C-terminus functions as an ATP-dependent DNA motor, moving dsDNA towards the difSL recombination site within the replication terminus region. It is crucial for XerS recombinase activation, enabling subsequent chromosome unlinking through recombination.
Database Links
Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of FtsK in Lactococcus lactis?

FtsK in Lactococcus lactis is a double-stranded DNA translocase that functions as a molecular motor, converting ATP binding and hydrolysis energy into directional movement of DNA substrates. The protein contains three main structural regions: the N-terminus involved in cell-cycle-specific localization and assembly of cell-division machinery, and the C-terminus which forms the motor domain . The motor portion can be further subdivided into three domains: α, β, and γ. The α and β domains multimerize to form a hexameric ring with a central channel that accommodates double-stranded DNA, while containing RecA-like nucleotide-binding/hydrolysis folds . The γ domain provides directional regulation by binding to specific polarized chromosomal sequences.

In L. lactis, FtsK is localized to the cell division septum where it functions as a DNA pump during late cell cycle stages, facilitating cytokinesis and chromosome segregation . It exhibits remarkable translocation speeds exceeding 5000 base pairs per second and generates sufficient force to displace other DNA-bound proteins .

How does FtsK directionality work in L. lactis compared to other bacterial species?

The directional movement of FtsK in L. lactis is controlled through a mechanism fundamentally similar to other bacteria but with species-specific recognition sequences. Directionality is conferred by the γ subdomain of FtsK, which recognizes and binds to specific chromosomal sequence motifs.

While in E. coli and many γ-Proteobacteria, FtsK recognizes 5′-GGGNAGGG-3′ sequences (known as KOPS - FtsK-Orienting Polar Sequences) , L. lactis FtsK recognizes a distinctly different motif: 5′-GAAGAAG-3′ . This heptamer differs both in sequence composition (being A-rich rather than G-rich) and in length from the octamers found in other bacteria . These recognition sequences are skewed in orientation throughout the bacterial chromosome, always directing FtsK translocation toward the terminus region where replication typically terminates, and specifically toward the dif site located in this region .

Experimental evidence confirms this specificity, as L. lactis FtsK (specifically its γ domain) does not recognize E. coli KOPS motifs, and similarly, E. coli FtsK does not respond to L. lactis KOPS motifs . This species-specific adaptation of the FtsK-KOPS system demonstrates evolutionary divergence while maintaining the core functional mechanism.

What are the optimal methods for expressing and purifying recombinant L. lactis FtsK for in vitro studies?

For effective expression and purification of recombinant L. lactis FtsK protein, researchers should consider the following methodology based on established protocols:

  • Expression System Selection: Use E. coli BL21(DE3) strain containing a pET-based expression vector with the L. lactis ftsK gene (either full-length or the C-terminal motor domain, depending on experimental requirements).

  • Construct Design: For studying motor function specifically, construct chimera proteins containing multiple copies of the FtsK γ subdomain (such as the 3γLl protein described in the literature, analogous to the 3γEc construct used for E. coli FtsK studies) .

  • Induction Parameters: Culture cells at 37°C until OD600 of 0.6-0.8, then induce with 0.5-1.0 mM IPTG and reduce temperature to 18-25°C for 4-6 hours to enhance protein solubility.

  • Purification Strategy:

    • Lyse cells using French press or sonication in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, 1 mM DTT, and protease inhibitors

    • Purify using affinity chromatography (Ni-NTA for His-tagged constructs)

    • Further purify by ion exchange chromatography followed by size exclusion chromatography

  • Quality Control: Verify protein purity by SDS-PAGE and confirm functional activity through ATP hydrolysis assays prior to experimental use.

The yield and purity of recombinant FtsK protein should be assessed by comparing samples to known protein standards, with expected molecular weights of approximately 147 kDa for full-length protein and around 50-70 kDa for the C-terminal motor domain constructs.

How can researchers accurately measure FtsK translocation activity and directionality in vitro?

To accurately measure FtsK translocation activity and directionality in vitro, researchers should implement a multi-faceted approach:

  • Electrophoretic Mobility Shift Assays (EMSA):

    • Design DNA substrates containing three consecutive KOPS motifs (5′-GAAGAAG-3′ for L. lactis FtsK)

    • Incubate purified FtsK protein (particularly the γ domain constructs) with labeled DNA substrates

    • Analyze binding by native gel electrophoresis to detect protein-DNA complexes

    • Include control substrates with non-specific sequences or KOPS motifs from other species

  • Single-Molecule Techniques:

    • Use optical or magnetic tweezers to measure FtsK translocation along DNA in real-time

    • Design DNA substrates with KOPS motifs in different orientations

    • Measure translocation speed (expected >5000 bp/second) and force generation

  • TIRF Microscopy:

    • Label DNA and FtsK with fluorescent markers

    • Observe translocation events on surface-tethered DNA molecules

    • Quantify directional bias and processivity

  • ATP Hydrolysis Assays:

    • Measure ATP consumption rates during translocation using coupled enzymatic assays

    • Compare hydrolysis rates with different DNA substrates (with/without KOPS, different KOPS orientations)

  • Triple-Helix Displacement Assays:

    • Design DNA substrates with triplex-forming oligonucleotides as displacement markers

    • Measure the time required for FtsK to displace these markers when translocating in either direction

DNA Substrate ConfigurationExpected FtsK BindingExpected Translocation DirectionATP Hydrolysis Rate
No KOPS motifsNon-specific, lowRandomBaseline
KOPS in permissive orientationStrong, specificToward terminus/difEnhanced
KOPS in non-permissive orientationStrong, specificAway from terminus/difEnhanced
E. coli KOPSNo binding (L. lactis FtsK)No directed translocationBaseline
Multiple permissive KOPSStrongestMost directedHighest

These assays collectively provide a comprehensive assessment of FtsK translocation activity, helping researchers characterize both wild-type and mutant versions of the protein.

How do FtsK sequences and activities differ between dairy and plant-derived L. lactis strains?

FtsK sequences and activities show notable variations between dairy and plant-derived L. lactis strains, reflecting their adaptation to different ecological niches:

The genomic analysis of L. lactis strains reveals that plant isolates retain numerous gene clusters that have been lost in dairy isolates . While specific FtsK sequence variations are not explicitly detailed in the provided references, this pattern of genetic differentiation likely extends to the regulatory regions and possibly the coding sequences of DNA processing enzymes like FtsK.

G+C content analysis strongly suggests that the genetic differences observed in plant isolates represent ancient genes that were subsequently lost in dairy strains during their adaptation to the nutrient-rich milk environment . This indicates that dairy strains of L. lactis have undergone reductive evolution, potentially affecting FtsK function and regulation.

The L. lactis strains isolated from plant environments (such as KF147 and KF282) show distinct genetic profiles compared to dairy isolates, with G+C content of unique gene clusters averaging around 35-36% . This is significant as the KOPS motifs recognized by FtsK in L. lactis are A-rich (5′-GAAGAAG-3′) , and variations in genomic G+C content could influence the distribution and frequency of these motifs across the chromosome.

For researchers working with different L. lactis strains, it is essential to consider these strain-specific variations when designing experiments involving FtsK, particularly when:

  • Cloning FtsK genes from different strains

  • Analyzing KOPS distribution and orientation across genomes

  • Interpreting translocation activities in heterologous systems

  • Investigating the integration of FtsK activity with other cellular processes

What evolutionary implications can be drawn from the KOPS sequence differences between bacterial species?

The differences in KOPS sequences between bacterial species offer profound insights into evolutionary processes:

The second hypothesis appears more likely, as bacterial chromosomes typically contain numerous motifs with remarkable skews and distributions. For example, the 5′-GAAGAAGA-3′ octamer (which contains the L. lactis KOPS) is extremely over-represented across diverse bacterial phyla .

The evolutionary plasticity of the FtsK-KOPS system demonstrates how DNA-protein recognition systems can diverge while maintaining essential functions in chromosome dynamics, providing insights into the molecular mechanisms of genome organization evolution.

What in vivo assays can accurately measure FtsK activity in L. lactis?

To accurately assess FtsK activity in L. lactis using in vivo approaches, researchers can implement several complementary methods:

  • XerS/difSL Recombination Assays:

    • Construct strains containing reporter systems with difSL sites flanking a selectable or screenable marker

    • Measure recombination frequencies as a proxy for FtsK activity, as FtsK translocation is required for XerS-mediated recombination at difSL sites

    • Compare recombination frequencies between wild-type and FtsK mutant strains

  • KOPS Orientation Impact Studies:

    • Design experiments similar to those performed with E. coli, where non-permissive KOPS motifs were positioned adjacent to dif sites

    • Insert different numbers of 5′-GAAGAAG-3′ motifs in non-permissive orientations near difSL sites

    • Quantify recombination frequency reduction (expected to decrease up to 100-fold with three consecutive non-permissive KOPS motifs)

  • Chromosome Segregation Analysis:

    • Use fluorescence microscopy with chromosome locus-specific markers to track chromosome segregation dynamics

    • Compare segregation timing and efficiency between wild-type and FtsK-mutant strains

    • Quantify chromosome dimer resolution defects in FtsK mutants

  • Cell Division Phenotype Assessment:

    • Analyze cell morphology and division defects using phase-contrast and fluorescence microscopy

    • Quantify cell chaining, filamentous growth, and nucleoid positioning in FtsK mutants

    • Correlate division defects with specific FtsK functional domains

  • Chimeric FtsK Activity Assays:

    • Construct strains expressing chimeric FtsK proteins combining domains from different species

    • Measure complementation of FtsK defects to determine domain functionality

    • Use systems similar to the E. coli strain carrying the C-terminal part of L. lactis ftsK in place of its E. coli counterpart

Experimental SystemMeasurementExpected WT ResultExpected in FtsK Mutant
difSL recombinationRecombination frequencyHigh efficiencySignificantly reduced
Non-permissive KOPS (3x) near difSLRecombination frequency~100-fold reductionMinimal additional effect
Chromosome segregationSegregation timingEfficient, synchronizedDelayed, asynchronous
Cell divisionCell morphologyNormal, separated cellsChains, filamentation
Chimeric FtsKComplementation of functionSpecies-specific activityDomain-dependent restoration

These assays should be performed under standardized growth conditions appropriate for L. lactis, typically M17 medium supplemented with glucose or lactose at 30°C, to ensure reproducibility and comparability of results.

How can researchers effectively study the interaction between L. lactis FtsK and the XerS/difSL system?

To effectively study the interaction between L. lactis FtsK and the XerS/difSL system, researchers should employ a structured approach combining biochemical, genetic, and imaging techniques:

  • Protein-Protein Interaction Assays:

    • Perform bacterial two-hybrid or co-immunoprecipitation experiments to detect direct interactions between FtsK and XerS

    • Use purified proteins for in vitro pull-down assays with control experiments to verify specificity

    • Map interaction domains through truncation and point mutation analysis

  • DNA-Binding and Competition Assays:

    • Conduct EMSAs with purified FtsK and XerS proteins on difSL-containing DNA

    • Test competitive and cooperative binding using varying protein concentrations

    • Perform DNase footprinting to identify protected regions during complex formation

  • Recombination Activation Assays:

    • Develop in vitro recombination systems using purified XerS, FtsK, and difSL-containing DNA substrates

    • Measure recombination rates with wild-type and mutant versions of FtsK

    • Assess the impact of KOPS orientation on recombination activation

  • Real-Time Visualization:

    • Use fluorescently labeled proteins to visualize FtsK-XerS-difSL complex formation by TIRF microscopy

    • Track complex dynamics during the cell cycle using time-lapse microscopy

    • Correlate complex formation with chromosome segregation events

  • Structure-Function Analysis:

    • Generate specific mutations in the FtsK γ domain and assess their effects on XerS activation

    • Design analogous experiments to those performed with E. coli FtsK and XerCD/dif, accounting for the distinct nature of the L. lactis XerS/difSL system

    • Compare results with the established E. coli model to identify conserved and divergent mechanisms

  • Heterologous Expression Studies:

    • Express L. lactis XerS and FtsK in E. coli systems to isolate their interaction from other species-specific factors

    • Test cross-species activation capabilities to determine specificity determinants

    • Construct chimeric proteins to map functional domains responsible for species-specific recognition

ComponentFunction in ComplexExperimental ApproachExpected Observation
FtsK C-terminusXerS activation, DNA translocationMutation analysisReduced recombination with γ-domain mutations
XerSDNA binding, strand exchangeBinding assays with FtsKEnhanced binding to difSL in presence of FtsK
difSLRecombination substrateDNA structure modificationsSequence-specific requirements for complex assembly
KOPS orientationDirectionality determinantOrientation inversionsAltered recombination efficiency

Understanding this interaction is crucial because L. lactis possesses an atypical Xer system (XerS/difSL) that uses a single recombinase instead of the two recombinases (XerC and XerD) found in classical Xer systems . Despite this difference, chromosome dimer resolution by XerS/difSL still requires the chromosome translocation activity of FtsK , indicating a conserved but mechanistically distinct process.

How can CRISPR-Cas9 technology be optimized for editing the ftsK gene in L. lactis?

Optimizing CRISPR-Cas9 technology for precise ftsK gene editing in L. lactis requires addressing several species-specific challenges:

  • Vector System Design:

    • Use theta-replicating plasmids with appropriate L. lactis compatible origins of replication (e.g., pWV01-derived)

    • Employ inducible promoters such as PnisA (nisin-inducible) for controlled Cas9 expression

    • Include temperature-sensitive replication elements for plasmid curing after editing

  • sgRNA Design Considerations:

    • Select target sequences with NGG PAM sites in ftsK while accounting for L. lactis's AT-rich genome

    • Avoid targeting regions containing KOPS motifs (5′-GAAGAAG-3′) to prevent disruption of functional elements

    • Verify sgRNA specificity against the L. lactis genome to minimize off-target effects

    • Design sgRNAs with the following parameters:

      • GC content: 40-60%

      • Avoid polyT sequences (>4 consecutive Ts)

      • Target regions 50-100 bp from intended mutation site

  • Homology-Directed Repair Template Design:

    • Construct repair templates with homology arms 500-1000 bp for efficient recombination

    • Introduce silent mutations in the PAM site or seed region to prevent re-cutting

    • Consider using ssDNA oligos for point mutations and dsDNA fragments for larger modifications

  • Transformation Protocol Optimization:

    • Use electroporation with glycine-supplemented media pre-treatment to weaken cell wall

    • Optimize electroporation parameters: 2.0-2.5 kV, 25 μF, 200-400 Ω

    • Include recovery phase in non-selective media supplemented with cell wall precursors

  • Screening Strategy:

    • Design PCR primers flanking the edited region for rapid screening

    • Use RFLP analysis if edit introduces or removes restriction sites

    • Confirm edits by Sanger sequencing and functional assays

Editing GoalRecommended ApproachKey Considerations
Point mutationsssDNA oligo-mediated HDRIntroduce PAM site mutation, 60-90 nt homology arms
Domain deletionsdsDNA fragment with homology armsMaintain reading frame, verify domain boundaries
Reporter fusionsdsDNA with fluorescent protein geneC-terminal fusions preferable, use flexible linkers
KOPS motif modificationsPrecise editing with minimal changesMaintain genomic context, validate using in vivo assays

When targeting the ftsK gene, researchers should be particularly cautious about maintaining essential functions while modifying specific domains. For example, the N-terminal domain is involved in cell division processes, while the C-terminal motor domains (α, β, γ) control DNA translocation and XerS activation . Disruption of essential domains may require complementation strategies or conditional approaches to prevent lethal phenotypes.

What strategies can be used to study the impact of KOPS distribution alterations on chromosome segregation?

To investigate how alterations in KOPS distribution affect chromosome segregation in L. lactis, researchers can implement several sophisticated strategies:

  • Genome-Wide KOPS Mapping and Modification:

    • Use bioinformatic tools to map natural 5′-GAAGAAG-3′ motif distribution across the L. lactis genome

    • Create strains with systematically altered KOPS distributions through CRISPR-Cas9 genome editing

    • Design modifications that:

      • Invert KOPS orientations in specific regions

      • Introduce additional KOPS motifs in non-native locations

      • Remove or mutate natural KOPS motifs in defined chromosome segments

  • High-Resolution Chromosome Dynamics Analysis:

    • Implement ParB-parS or FROS (Fluorescent Repressor-Operator System) to visualize specific chromosome loci

    • Use time-lapse microscopy to track chromosome movement in cells with altered KOPS distributions

    • Analyze segregation timing, directionality, and efficiency quantitatively

    • Measure FtsK-dependent DNA translocation rates in vivo using site-specific recombination kinetics

  • Synthetic Chromosome Region Construction:

    • Engineer synthetic chromosome regions with controlled KOPS density and orientation

    • Insert these constructs at different positions relative to the terminus region

    • Assess the impact on local and global chromosome dynamics

    • Test the minimum KOPS density required for efficient FtsK-mediated translocation

  • FtsK Loading and Activity Assays:

    • Develop ChIP-seq protocols for FtsK to map its binding sites across the L. lactis genome

    • Compare wild-type KOPS distributions with engineered variants

    • Correlate FtsK binding patterns with chromosome segregation outcomes

    • Use ATP hydrolysis mutants of FtsK as controls for distinguishing binding from translocation effects

  • Comparative Systems Biology Approach:

    • Create mathematical models of chromosome segregation based on KOPS distribution data

    • Simulate alterations and predict segregation outcomes

    • Validate predictions experimentally using the strategies above

    • Compare results with other bacterial species to identify conserved principles

KOPS ModificationExpected Impact on SegregationExperimental Readout
KOPS inversion in terminus regionDelayed dimer resolutionIncreased cell chaining, nucleoid bisection defects
KOPS density reductionDecreased FtsK loading efficiencySlower translocation rates, segregation delays
KOPS orientation randomizationDirectional confusionIncreased chromosome nondisjunction
Introduction of conflicting KOPSLocal segregation defectsRegion-specific segregation delays
KOPS replacement with E. coli motifsNo recognition by L. lactis FtsKComparable to KOPS deletion

These experimental approaches will help elucidate the fundamental principles governing chromosome organization and processing during bacterial cell division, while specifically addressing the unique characteristics of the L. lactis FtsK-KOPS system .

How can researchers overcome expression challenges when working with recombinant FtsK proteins?

Working with recombinant FtsK presents several expression challenges due to its large size, membrane association, and complex domain structure. Here are effective strategies to overcome these issues:

  • Domain-Based Expression Approach:

    • Express functional domains separately rather than the full-length protein

    • Focus on the C-terminal motor domain (50-70 kDa) which contains the translocation activity

    • Create fusion constructs with multiple γ domains (similar to the 3γLl construct) for DNA binding studies

    • Validate domain functionality through complementation assays

  • Expression System Optimization:

    • Use specialized E. coli strains designed for membrane/toxic protein expression (C43(DE3), Lemo21(DE3))

    • Implement tight expression control with tunable promoters (T7lac, araBAD)

    • Culture at reduced temperatures (16-20°C) to improve folding

    • Include molecular chaperones (GroEL/ES, DnaK/J) to enhance solubility

    • Consider cell-free expression systems for difficult constructs

  • Solubility Enhancement Strategies:

    • Add solubility tags (MBP, SUMO, TrxA) with precise protease cleavage sites

    • Optimize buffer conditions with stabilizing agents (glycerol, arginine, low concentrations of non-ionic detergents)

    • Use computational tools to identify and modify aggregation-prone regions

    • Implement directed evolution or consensus design approaches to generate more soluble variants

  • Purification Protocol Refinement:

    • Develop multi-step purification protocols with orthogonal techniques

    • Include on-column refolding steps if necessary

    • Optimize elution conditions to prevent aggregation

    • Implement size exclusion chromatography as a final polishing step

    • Verify protein activity after each purification stage

DomainExpression ChallengeRecommended StrategyExpected Yield
Full-length FtsKMembrane association, toxicityCell-free system, specialized strainsLow (0.1-0.5 mg/L)
N-terminal domainMembrane integrationDetergent solubilization, fusion tagsModerate (0.5-2 mg/L)
Motor domain (α+β)ATP binding pocket integrityLow temperature, chaperone co-expressionGood (2-5 mg/L)
γ domainRelatively small, solubleStandard expression, MBP fusionExcellent (5-10 mg/L)
Multi-γ constructs (3γLl)Designed for solubilityStandard expression protocolsVery good (3-8 mg/L)

For functional validation, researchers should implement activity assays at each stage of optimization to ensure that improvements in expression yield do not come at the cost of reduced functionality. ATP hydrolysis assays and DNA binding tests serve as rapid initial screens before proceeding to more complex translocation assays.

What are the critical controls needed when studying FtsK-KOPS interactions?

When investigating FtsK-KOPS interactions, implementing rigorous controls is essential for generating reliable and interpretable data. The following controls should be incorporated into experimental designs:

  • DNA Substrate Controls:

    • Non-specific DNA sequences: DNA fragments lacking KOPS motifs to establish baseline binding/activity

    • Scrambled KOPS motifs: Maintaining nucleotide composition but disrupting sequence specificity

    • Heterologous KOPS motifs: E. coli KOPS (5′-GGGNAGGG-3′) should not be recognized by L. lactis FtsK

    • KOPS density variations: Different numbers of KOPS motifs (single vs. multiple) to establish dose-dependency

    • Orientation controls: KOPS in permissive vs. non-permissive orientations to confirm directional bias

  • Protein Variant Controls:

    • FtsK γ domain deletion: Removing the DNA-binding domain should eliminate KOPS recognition

    • FtsK ATP hydrolysis mutants: Distinguish between binding and translocation activities

    • Heterologous FtsK proteins: E. coli FtsK should not recognize L. lactis KOPS motifs

    • Chimeric proteins: Swap γ domains between species to confirm specificity determinants

    • Concentration gradients: Establish specific vs. non-specific binding thresholds

  • Experimental System Controls:

    • In vitro vs. in vivo correlation: Confirm that in vitro observations translate to cellular context

    • Temporal controls: Account for cell-cycle dependence of FtsK activity

    • Environmental factors: Test effects of pH, temperature, and salt concentration

    • Competitive inhibition: Use excess non-labeled DNA with/without KOPS to demonstrate specificity

  • Analytical Controls:

    • Statistical validation: Perform sufficient replicates for robust significance testing

    • Multiple technique verification: Confirm observations using orthogonal methods

    • Recombination system controls: Test XerS/difSL system function independently of FtsK alterations

Experimental ApproachEssential ControlsExpected OutcomesInterpretation
EMSA with 3γLl proteinNo protein; E. coli KOPS; scrambled motifsBinding only to L. lactis KOPSSequence specificity confirmed
Translocation assaysATP-γS; Walker A/B mutantsBinding without translocationEnergy requirement verified
XerS activation testsXerS catalytic mutants; difSL variantsNo recombination despite FtsK activityPathway-specific effects
In vivo recombinationNon-permissive KOPS orientation~100-fold reduction with 3x KOPS Directionality confirmed
Cross-species testsE. coli FtsK with L. lactis KOPSNo activity enhancementSpecies-specificity verified

By implementing these controls systematically, researchers can distinguish between specific FtsK-KOPS interactions and non-specific DNA binding or translocation activities, providing robust evidence for the directionality mechanisms of FtsK in L. lactis chromosome segregation .

What emerging technologies could advance the study of FtsK function in L. lactis?

Several cutting-edge technologies offer promising avenues for deeper understanding of FtsK function in L. lactis:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Determine high-resolution structures of L. lactis FtsK hexamers in different nucleotide-bound states

    • Visualize FtsK-DNA complexes to understand conformational changes during translocation

    • Compare structures with E. coli FtsK to identify species-specific adaptations

    • Resolution capabilities now reaching 2-3Å for large macromolecular complexes

  • Single-Molecule Real-Time Techniques:

    • Apply DNA curtain technology to visualize multiple FtsK molecules translocating simultaneously

    • Use multi-color TIRF microscopy to track FtsK, XerS, and DNA dynamics in real-time

    • Implement high-speed AFM to observe conformational changes during translocation

    • Measure force generation using optical/magnetic tweezers with improved spatiotemporal resolution

  • Advanced Genome Engineering:

    • Apply CRISPR-Cas9 with base editors for precise KOPS modification without double-strand breaks

    • Create minimal synthetic chromosomes with engineered KOPS distributions

    • Develop orthogonal chromosome segregation systems to test mechanistic models

    • Implement genome-wide CRISPR screening to identify new factors influencing FtsK function

  • Systems Biology Approaches:

    • Develop mathematical models of chromosome segregation incorporating FtsK-KOPS interactions

    • Create agent-based simulations of multiple FtsK motors operating simultaneously

    • Apply machine learning to predict global effects of local KOPS alterations

    • Integrate multi-omics data to understand FtsK regulation networks

  • Advanced Imaging Technologies:

    • Implement super-resolution microscopy (PALM/STORM) to track FtsK localization with 10-20nm precision

    • Use lattice light-sheet microscopy for long-term 4D imaging with reduced phototoxicity

    • Apply expansion microscopy to visualize FtsK-DNA interactions at enhanced apparent resolution

    • Develop FRET-based biosensors to detect FtsK conformational changes in vivo

These technologies would enable researchers to address key outstanding questions, such as how multiple FtsK hexamers coordinate their activities during segregation, how the motor handles DNA-bound proteins, and how FtsK activity is integrated with other cell cycle processes in L. lactis.

How might understanding FtsK in L. lactis contribute to broader bacterial chromosome biology?

Understanding FtsK in L. lactis has significant implications for the broader field of bacterial chromosome biology in several dimensions:

By studying FtsK in L. lactis, researchers can leverage the unique features of this model organism—its compact genome, atypical Xer system, and distinct KOPS motifs—to uncover both conserved principles and divergent solutions in bacterial chromosome biology. This comparative approach strengthens our understanding of fundamental mechanisms while revealing the evolutionary plasticity that allows essential systems to adapt to different genomic contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.