Recombinant Lactococcus lactis subsp. cremoris Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Description

Role in ECF Transporter Function

ECF transporters mediate ATP-dependent uptake of vitamins and micronutrients in bacteria. EcfT serves as the transmembrane scaffold, coordinating energy transfer between ATP hydrolysis (via EcfA/A') and substrate binding (via S-components) .

Key Functional Attributes:

  • Quaternary Structure: Forms a stable complex with EcfA, EcfA', and variable S-components (e.g., BioY for biotin, RibU for riboflavin) .

  • Substrate Diversity: A single EcfT module can pair with multiple S-components, enabling transport of diverse substrates :

S-ComponentSubstrateGene ID (L. lactis)
BioYBiotinllmg_1964
RibURiboflavinllmg_1195
ThiTThiaminellmg_0334
PanTPantothenatellmg_0542
  • Mechanism: ATP hydrolysis by EcfA/A' induces conformational changes in EcfT, driving substrate translocation through the S-component .

Recombinant Production and Characterization

The recombinant EcfT protein (Product ID: RFL16651LF) is produced in E. coli with the following specifications :

ParameterDetails
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water, with 5–50% glycerol for long-term storage
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles

Notable Features:

  • Full-length sequence (1–266 aa) preserves native structural integrity.

  • High purity (>90%) ensures reliability in biochemical assays .

4.1. Mechanistic Studies

  • Structural Biology: EcfT’s interaction with S-components has been resolved via cryo-EM and X-ray crystallography, revealing dynamic substrate-binding interfaces .

  • Transport Assays: Reconstitution of EcfT-containing complexes in proteoliposomes demonstrates ATP-dependent vitamin uptake .

4.2. Antimicrobial Targeting

ECF transporters are absent in humans, making EcfT a candidate for narrow-spectrum antibiotics. Inhibitors targeting the EcfT-S-component interface block vitamin uptake in pathogens like Lactobacillus delbrueckii .

4.3. Industrial Relevance

  • Strain Engineering: Adaptive evolution of L. lactis under stress (e.g., cell envelope stressors) has identified mutations in EcfT-associated pathways, informing starter culture optimization .

  • Probiotic Development: While not directly linked to EcfT, L. lactis subsp. cremoris strains modulate host immunity via TLR2/MyD88 signaling, highlighting the genus’s biomedical potential .

Future Directions

  • Drug Discovery: High-throughput screening of EcfT inhibitors could yield novel antimicrobials .

  • Synthetic Biology: Engineering chimeric ECF transporters with tailored S-components may enable targeted nutrient delivery systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ecfT; llmg_0289; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Lactococcus lactis subsp. cremoris (strain MG1363)
Target Names
ecfT
Target Protein Sequence
MQNMLMGRYIPGDSIIHRMDPRSKLLVMIAFVVIIFLAHDWLGYLLLVLYTLAGVLLSKI SVSYFLRGLRPMIGLILFTVIFQMLFTNGQHVIFSLWFIKISTESLINAVYIFFRFVLII FMSTILTLTTPPLTLADGIEKGLGPLKKIKVPVHELGLMLSISLRFIPTLMDDTTMIMNA QKARGMDFGEGNLLKKIKSVIPILIPLFVSSFRRADDLAVAMESRGYQGGDGRTKYRQLK WQSRDSLLVVSIIIMTILLILWSKVS
Uniprot No.

Target Background

Function
This protein is a component of a common energy-coupling factor (ECF) ABC-transporter complex. Unlike traditional ABC transporters, this ECF transporter provides the energy needed for the transport of various substrates. In this organism, these substrates likely include biotin, thiamine precursor, niacin, pantothenic acid, queuosine precursor, riboflavin, and thiamine. Uptake of niacin or riboflavin into proteosomes containing EcfA1A2T and Niax or RibU has been observed. This uptake requires hydrolyzable Mg-ATP and is substrate-specific; proteosomes containing NiaX did not transport riboflavin.
Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.