Recombinant Lactococcus lactis subsp. cremoris Multi-drug resistance efflux pump pmrA homolog (pmrA)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

  • Gene: The pmrA gene (UniProt ID: P27173) encodes a 119-amino-acid protein with 12 transmembrane helices, characteristic of MFS transporters .

  • Structural Model: AlphaFold predicts a global pLDDT score of 68.31, indicating moderate confidence in the computed structure (Figure 1) . Key domains include:

    • Transmembrane segments: Facilitate drug efflux across the cell membrane.

    • Conserved motifs: Critical for substrate recognition and proton antiport activity .

Expression Systems

Recombinant PmrA is produced in heterologous hosts with ≥85% purity (SDS-PAGE) :

Host SystemPurityApplications
E. coli≥85%Drug resistance assays
Yeast/Baculovirus≥85%Structural studies
Mammalian Cells≥85%Functional characterization

Functional Role in Multidrug Resistance

PmrA homologs mediate resistance by extruding structurally unrelated antibiotics, including:

  • Macrolides (e.g., erythromycin)

  • Tetracyclines

  • Fluoroquinolones (e.g., ciprofloxacin) .

Mechanism

  • Energy Coupling: Utilizes proton gradient for active transport .

  • Substrate Specificity: Broad specificity for cationic and hydrophobic compounds .

Upregulation in Resistant Strains

Transcriptomic studies reveal pmrA upregulation in drug-resistant Lactococcus lactis strains, correlating with enhanced efflux activity . For example:

  • Deletion of pmrA homologs in Streptococcus pneumoniae restores susceptibility to fluoroquinolones .

  • Overexpression in E. coli increases MICs for tetracycline by 4–8-fold .

Interactions with Efflux Inhibitors

  • Reserpine: A plant alkaloid that inhibits PmrA homologs, reducing MICs for erythromycin and ciprofloxacin by 50–75% .

Drug Resistance Studies

  • Model System: Used to dissect MDR mechanisms in Gram-positive bacteria .

  • Inhibitor Development: High-throughput screens leverage recombinant PmrA to identify novel efflux pump inhibitors .

Vaccine Delivery Vectors

Engineered L. lactis strains expressing PmrA homologs serve as mucosal vaccine vectors, though efflux activity may require modulation to retain therapeutic compounds .

Comparative Analysis of PmrA Homologs

SpeciesFunctionSubstratesResistance Profile
L. lactis subsp. cremorisDrug effluxMacrolides, tetracyclinesAcquired and intrinsic MDR
S. pneumoniaeFluoroquinolone resistanceCiprofloxacin, norfloxacinReserpine-reversible
S. mutansGlutamine metabolism regulationN/ApH-dependent gene regulation

Future Directions

  • Structural Optimization: Refining AlphaFold models via cryo-EM to resolve substrate-binding pockets .

  • Clinical Relevance: Investigating PmrA’s role in biotherapeutic strains (e.g., probiotics) to prevent unintended antibiotic resistance .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format preferences, kindly indicate your requirement when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
pmrA; Multi-drug resistance efflux pump PmrA homolog; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Lactococcus lactis subsp. cremoris (Streptococcus cremoris)
Target Names
pmrA
Target Protein Sequence
ILIGLVFTFVIYLPMAFVQSPLQLGILRFLLGFGAGALMPSVNSLLSKITPKEGVSRIFA YAQMCSNLGMVTGPLVGSAIAGYISYRAAIVGTSLFVIVNIIWSFINFRKYLRKRSIME
Uniprot No.

Target Background

Protein Families
Major facilitator superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lactococcus lactis subsp. cremoris and why is it significant for recombinant protein expression?

Lactococcus lactis subsp. cremoris is a nonpathogenic, AT-rich gram-positive bacterium closely related to the genus Streptococcus and is commonly used as a cheese starter . L. lactis subsp. cremoris MG1363 serves as the international archetype for lactic acid bacteria (LAB) genetics; it is a plasmid-free and phage-cured derivative of the dairy starter strain NCDO712, lacking extracellular proteases . The significance of L. lactis for recombinant protein expression stems from several key characteristics:

  • Safety profile: L. lactis has an excellent safety profile resulting from years of human consumption in the food industry, and lacks toxicity and immunogenicity .

  • GRAS status: It has been granted "generally regarded as safe" (GRAS) status by the FDA .

  • Non-colonizing: Unlike many other bacteria, L. lactis does not colonize the gastrointestinal tract of humans and animals, limiting environmental persistence .

  • Genetic tractability: The complete genome sequencing of L. lactis strains has facilitated the development of numerous genetic tools for engineering these bacteria .

For recombinant protein expression, researchers typically use expression vectors designed specifically for L. lactis, with various promoter systems that can be constitutive or inducible, depending on experimental requirements.

What is the PmrA efflux pump and how does it contribute to antimicrobial resistance?

The PmrA (pneumococcal multidrug resistance protein) efflux pump is a multidrug resistance protein identified in Streptococcus pneumoniae that contributes to antimicrobial resistance through active efflux of compounds from the bacterial cell . Key characteristics of PmrA include:

  • Structural features: PmrA belongs to the major facilitator system (MFS) pump family and contains 12 transmembrane segments (TMS) .

  • Sequence homology: The protein shares 24% amino acid sequence identity with both NorA and Bmr efflux pumps .

  • Resistance mechanism: When active, PmrA can confer resistance to fluoroquinolones and other compounds by actively pumping them out of the bacterial cell .

  • Conservation: The PmrA gene is present in all examined strains of S. pneumoniae, suggesting it's a conserved component .

Experimental evidence has shown that insertional inactivation of the PmrA gene in fluoroquinolone-resistant pneumococci with an efflux phenotype causes reversion to drug sensitivity . Resistance phenotypes are likely the result of increased PmrA pump expression rather than the mere presence of the gene .

How are homologs of efflux pump genes identified in bacterial genomes?

The identification of efflux pump gene homologs, such as PmrA homologs in L. lactis subsp. cremoris, typically follows this methodological approach:

  • Genomic database screening: Nucleotide sequence data from genome projects are screened against established databases (like EMBL) using sequence alignment tools such as FASTA .

  • Homology assessment: Sequences showing homology with known efflux pump genes (e.g., norA or bmr) are identified and analyzed for open reading frames (ORFs) .

  • PCR amplification: DNA segments containing the potential homolog are amplified using PCR with specifically designed primers that include appropriate restriction sites .

  • Restriction analysis: PCR products undergo restriction digest analysis to verify the presence and structure of the putative efflux pump gene .

  • Southern blotting: This technique confirms the presence and copy number of the efflux gene on the bacterial chromosome .

  • DNA sequencing: Final confirmation comes from sequencing the PCR products and comparing them with known efflux pump sequences .

For example, in S. pneumoniae, researchers identified a PmrA homolog by screening genomic sequence data against the EMBL prokaryote library, which revealed an ORF of 1,200 bp with 52% homology to a 430-nucleotide overlap with norA .

What are the optimal strategies for constructing recombinant L. lactis strains expressing functional PmrA homologs?

Constructing recombinant L. lactis strains that express functional PmrA homologs requires a sophisticated approach to ensure proper gene integration, expression, and functionality:

  • Vector selection: For L. lactis subsp. cremoris, specialized expression vectors adapted for gram-positive bacteria should be used, particularly those with promoters active in LAB .

  • Codon optimization: The PmrA homolog sequence should be codon-optimized for L. lactis to ensure efficient translation, as L. lactis has an AT-rich genome that may affect expression efficiency .

  • Expression control: Consider using:

    • Constitutive promoters (e.g., P59 promoter) for continuous expression

    • Inducible systems (e.g., nisin-inducible expression system) for controlled expression

  • Cellular localization strategies:

    • Intracellular expression: Simplest approach but may lead to protein degradation

    • Cell wall anchoring: Can provide stronger functional responses in some applications

    • Secretion: Using signal peptides for extracellular delivery

  • Gene integration methodology: Use multiplex long accurate PCR (MLA PCR) for targeted gene integration, a technique successfully employed in genome sequencing projects .

  • Verification of expression: Implement Western blotting, functional assays, and fluorescent tagging to confirm expression and localization.

  • Functional assessment: Evaluate antimicrobial resistance profiles with and without efflux pump inhibitors (e.g., reserpine) to confirm functional expression.

When selecting the L. lactis strain, consider that L. lactis subsp. cremoris MG1363 offers advantages for laboratory use, as it lacks the pLP712 plasmid that encodes the lac operon and proteases necessary for casein degradation, which limits propagation outside controlled environments .

How does the substrate specificity of PmrA homologs in L. lactis compare with PmrA in S. pneumoniae, and what experimental approaches best characterize these differences?

Characterizing and comparing substrate specificity of PmrA homologs in L. lactis versus S. pneumoniae requires systematic experimental approaches:

  • Comparative substrate profiling:

    • Minimum inhibitory concentration (MIC) determination for multiple antibiotic classes

    • Efflux assays using fluorescent substrates (e.g., ethidium bromide, Hoechst 33342)

    • Radiolabeled substrate accumulation/efflux studies

  • Site-directed mutagenesis to identify specificity determinants:

    • Target transmembrane segments (TMSs) and conserved motifs (A, B, C, D2, and G) that are present in 12-TMS proton-dependent efflux pumps

    • Focus on non-conserved regions between homologs that may confer substrate differences

  • Chimeric protein construction:

    • Generate chimeric proteins by swapping domains between PmrA from S. pneumoniae and its L. lactis homolog

    • Evaluate substrate profiles of chimeric constructs to map specificity-determining regions

  • Competition assays:

    • Use labeled substrate efflux in the presence of unlabeled potential substrates

    • Determine IC50 values for competitive inhibition

  • Structural analysis:

    • Molecular modeling based on crystallized MFS transporters

    • Docking studies to predict substrate binding sites

  • Expression level normalization:

    • Use quantitative PCR and Western blotting to normalize expression levels

    • Ensure differences in substrate specificity aren't due to expression variations

A systematic comparative study would reveal whether differences in substrate specificity between PmrA in S. pneumoniae and its homologs in L. lactis exist and could identify the structural basis for these differences, informing both antimicrobial development and recombinant expression strategies.

What are the regulatory mechanisms controlling PmrA homolog expression in L. lactis, and how might they be manipulated for research applications?

Understanding and manipulating regulatory mechanisms controlling PmrA homolog expression in L. lactis requires investigation of:

  • Promoter structure and function:

    • Analyze the 5' region of the gene for promoter elements, transcription start sites, and Shine-Dalgarno sequences compatible with L. lactis expression patterns

    • Map transcription factor binding sites through DNase footprinting and electrophoretic mobility shift assays (EMSA)

  • Regulatory factors:

    • Identify putative transcriptional regulators through:

      • Bioinformatic analysis for conserved binding sites

      • RNA-seq under various growth conditions

      • Chromatin immunoprecipitation (ChIP) assays

    • Characterize the role of global regulators vs. specific regulators

  • Environmental regulation:

    • Analyze expression levels under different:

      • Growth phases

      • Stress conditions (pH, temperature, oxidative stress)

      • Substrate concentrations

      • Antimicrobial exposures

  • Manipulation strategies:

    • Promoter engineering: Modify native promoters or replace with constitutive/inducible alternatives

    • Regulator overexpression/deletion: Express positive regulators or delete repressors

    • Two-component system modifications: If regulated by two-component systems, modify sensor kinases or response regulators

    • Riboswitch incorporation: Add synthetic riboswitches for post-transcriptional control

  • Verification methods:

    • Reporter gene fusion (e.g., luciferase, GFP) to monitor expression levels

    • qRT-PCR for transcriptional analysis

    • Western blotting for protein expression

    • Phenotypic assays for functional expression

Understanding these regulatory mechanisms would enable precise control over PmrA homolog expression, facilitating both basic research into efflux pump function and applied research for antimicrobial resistance studies or biotechnological applications.

What are the optimal methods for measuring efflux activity in recombinant L. lactis expressing PmrA homologs?

Several complementary methodologies can effectively measure efflux activity in recombinant L. lactis expressing PmrA homologs:

  • Fluorescent substrate accumulation/efflux assays:

    • Ethidium bromide accumulation assay:

      • Pre-load cells with ethidium bromide in the presence of an energy inhibitor

      • Measure fluorescence decrease over time after energy source addition

      • Compare efflux rates with and without efflux pump inhibitors (e.g., reserpine)

    • Hoechst 33342 accumulation:

      • Real-time measurement of intracellular accumulation

      • Lower accumulation indicates active efflux

  • Radiolabeled substrate transport assays:

    • Use radiolabeled antibiotics or other substrates

    • Measure intracellular accumulation over time

    • Calculate efflux rates from accumulation data

  • Minimum inhibitory concentration (MIC) determination:

    • Standard broth microdilution method with and without efflux inhibitors

    • Efflux ratio calculation: MIC without inhibitor / MIC with inhibitor

    • Test panel of potential substrates to determine specificity profile

  • Flow cytometry-based methods:

    • Single-cell analysis of substrate accumulation

    • Can identify heterogeneity in efflux activity within population

  • Membrane vesicle transport assays:

    • Prepare inside-out membrane vesicles containing expressed pumps

    • Measure ATP or proton gradient-dependent transport into vesicles

  • Microfluidic-based real-time monitoring:

    • Continuous monitoring of single cells in microfluidic chambers

    • Observe real-time responses to substrate and inhibitor additions

These approaches can be complemented with appropriate controls:

  • Empty vector control strains

  • Strains expressing known efflux pumps (positive controls)

  • Efflux-deficient mutants (negative controls)

  • Addition of metabolic inhibitors (e.g., CCCP) to demonstrate energy dependence

The combination of these methodologies provides a comprehensive assessment of efflux pump activity, substrate specificity, and inhibitor sensitivity in recombinant L. lactis expressing PmrA homologs.

How can genome editing techniques be optimized for introducing PmrA homolog mutations in L. lactis subsp. cremoris?

Optimizing genome editing techniques for PmrA homolog mutations in L. lactis subsp. cremoris requires careful consideration of several technical aspects:

  • CRISPR-Cas9 system optimization:

    • Design sgRNAs with high specificity for PmrA homolog target sites

    • Codon-optimize Cas9 for expression in L. lactis

    • Use temperature-sensitive plasmids for transient Cas9 expression

    • Provide repair templates with homology arms (500-1000 bp) flanking the cut site

    • Protocol optimization:

      ParameterOptimization RangeNotes
      sgRNA length18-22 ntExclude regions with secondary structures
      PAM selectionNGG sitesPrioritize targets with minimal off-targets
      Cas9 expression0.1-1% nisinTitrate for optimal cutting efficiency
      Recovery time3-24 hoursAllow for DNA repair and cell recovery
  • Recombineering approaches:

    • Use λ Red recombinase system adapted for L. lactis

    • Express recombinases (RecT, Beta) from controlled promoters

    • Introduce single-stranded DNA oligonucleotides (70-90 nt) for point mutations

    • Employ double-stranded DNA fragments with homology arms for larger modifications

  • Double-crossover homologous recombination:

    • Design suicide vectors with:

      • Temperature-sensitive origin of replication

      • Selectable markers (e.g., antibiotic resistance)

      • Counter-selectable markers (e.g., sacB)

    • Include 1-2 kb homology arms flanking the target region

    • Screen for double-crossover events using appropriate markers

  • Multiplex genome editing:

    • Adapt multiplex long accurate PCR (MLA PCR) methods used in genome sequencing projects

    • Design primers with homology to target regions

    • Create multiple mutations simultaneously through multiplexed editing

  • Verification strategies:

    • PCR amplification and sequencing of modified regions

    • Restriction enzyme digestion to confirm mutations

    • Whole-genome sequencing to verify the absence of off-target effects

    • Functional assays to confirm phenotypic changes

  • Strain-specific considerations for L. lactis subsp. cremoris:

    • Optimize transformation protocols specific to L. lactis (e.g., electroporation parameters)

    • Consider the AT-rich genome when designing homology arms and repair templates

    • Account for potential restriction-modification systems that may degrade foreign DNA

These optimized approaches enable precise genetic modifications of PmrA homologs in L. lactis, facilitating structure-function studies and biotechnological applications.

What experimental design is most effective for evaluating the potential of recombinant L. lactis strains expressing modified PmrA homologs as delivery vehicles for therapeutic proteins?

An effective experimental design for evaluating recombinant L. lactis strains expressing modified PmrA homologs as therapeutic protein delivery vehicles should include:

  • Construction of recombinant strains:

    • Generate multiple constructs with PmrA homologs modified for:

      • Altered substrate specificity

      • Enhanced expression

      • Modified regulation

    • Co-express therapeutic proteins using:

      • Constitutive promoters for continuous expression

      • Inducible systems for controlled expression

      • Different cellular localizations (intracellular, cell-wall anchored, secreted)

  • In vitro characterization:

    • Stability assessment:

      • Growth curves in different media

      • Plasmid retention over multiple generations

      • Protein expression stability

    • Protein delivery quantification:

      • ELISA for secreted proteins

      • Flow cytometry for cell-surface display

      • Western blotting for expression levels

    • Functional verification:

      • Bioactivity assays for the therapeutic protein

      • Efflux activity assays for PmrA function

  • Cell culture models:

    • Interaction with epithelial cell lines:

      • Adhesion and internalization assays

      • Transepithelial electrical resistance (TEER) measurements

      • Cytokine profiling to assess immunomodulatory effects

    • Co-culture with immune cells:

      • Dendritic cell maturation and cytokine production

      • T-cell differentiation studies (similar to YRC3780 effects on T-cell subsets)

      • Regulatory T-cell induction assessment

  • In vivo studies:

    • Biodistribution studies:

      • Tracking labeled bacteria in gastrointestinal tract

      • Persistence and clearance kinetics

      • Potential translocation assessment

    • Therapeutic protein delivery:

      • Local and systemic detection of the therapeutic protein

      • Biomarkers for biological activity

    • Safety assessment:

      • Histopathological evaluation

      • Inflammatory marker analysis

      • Microbiome impact studies

  • Comparison with control groups:

    • Wild-type L. lactis strains

    • L. lactis expressing therapeutic protein without PmrA modifications

    • L. lactis with inactive PmrA homologs

    • Purified therapeutic protein administration

  • Statistical analysis:

    • Power analysis for appropriate sample sizes

    • Mixed-effects models to account for repeated measures

    • Multiple comparison corrections for biomarker analyses

This comprehensive experimental design would effectively evaluate whether modified PmrA homologs enhance the capability of L. lactis to deliver therapeutic proteins and would provide insights into the mechanisms involved, similar to how researchers evaluated immunomodulatory effects of L. lactis subsp. cremoris YRC3780 .

How might PmrA homologs in L. lactis be utilized for developing novel antimicrobial resistance screening platforms?

PmrA homologs in L. lactis can be leveraged to develop innovative antimicrobial resistance screening platforms through several strategic approaches:

  • Reporter strain construction:

    • Engineer L. lactis to express PmrA homologs fused to fluorescent proteins

    • Create promoter-reporter fusions to monitor PmrA expression in response to various compounds

    • Develop dual-reporter systems to simultaneously monitor efflux activity and cellular stress

  • High-throughput screening applications:

    • Design 96/384-well plate-based fluorescence assays for rapid screening

    • Implementation in microfluidic devices for single-cell analysis

    • Development of biosensor arrays with multiple PmrA variants

  • Efflux pump inhibitor discovery platform:

    • Screen chemical libraries for compounds that inhibit PmrA homolog activity

    • Establish structure-activity relationships for inhibitor optimization

    • Develop combination screening for synergistic effects between inhibitors and antibiotics

  • Resistance mechanism characterization:

    • Systematic mutation of PmrA homologs to map resistance determinants

    • Evaluation of cross-resistance patterns between different antimicrobials

    • Assessment of adaptive responses through controlled evolution experiments

  • Comparative genomics platform:

    • Express PmrA homologs from different bacterial species in standardized L. lactis chassis

    • Directly compare substrate specificity and inhibitor sensitivity profiles

    • Identify conserved and variable features affecting resistance

  • Biotechnological applications:

    • Develop L. lactis strains with enhanced capacity to export recombinant proteins

    • Create biosensors for environmental detection of antimicrobials

    • Engineer strains with controlled resistance profiles for industrial fermentations

This approach leverages the safety profile of L. lactis while providing a standardized platform for studying diverse efflux pumps. It offers advantages over traditional resistance screening in pathogenic organisms, including biosafety, genetic tractability, and the ability to study pumps in isolation from other resistance mechanisms.

What are the key considerations for studying the immunomodulatory potential of recombinant L. lactis expressing PmrA homologs alongside therapeutic proteins?

Studying the immunomodulatory potential of recombinant L. lactis expressing both PmrA homologs and therapeutic proteins requires careful consideration of several factors:

  • Strain selection and engineering:

    • Choose appropriate L. lactis subspecies (e.g., L. lactis subsp. cremoris) with known immunomodulatory properties

    • Consider baseline immunomodulatory effects of the bacterial chassis

    • Design constructs with optimized expression of both PmrA homologs and therapeutic proteins

    • Evaluate different cellular locations for the therapeutic protein (intracellular, surface-anchored, secreted)

  • Dendritic cell (DC) interaction studies:

    • Assess effects on DC maturation markers (CD80, CD86, MHC II)

    • Evaluate cytokine production profiles (IL-10, IL-12, TNF-α)

    • Analyze gene expression changes in DCs after exposure (similar to MLN DC studies with YRC3780)

    • Compare with wild-type and non-expressing control strains

  • T cell polarization assessment:

    • Co-culture systems with DCs and T cells to evaluate:

      • Th1/Th2 balance

      • Regulatory T cell (Treg) induction

      • Th17 cell development

    • Cytokine profiling (IFN-γ, IL-4, IL-10, IL-17)

    • Expression analysis of transcription factors (T-bet, GATA-3, Foxp3, RORγt)

  • In vivo immune response evaluation:

    • Mucosal immune response assessment:

      • IgA production in intestinal secretions

      • Mucosal T cell populations

      • Gut-associated lymphoid tissue analysis

    • Systemic immune parameters:

      • Serum antibody levels

      • Peripheral T cell populations

      • Inflammatory marker assessment

  • Therapeutic protein-specific considerations:

    • Potential interactions between the therapeutic protein and bacterial immunomodulatory properties

    • Risk of immune responses against the therapeutic protein

    • Dosing and timing optimization for therapeutic effect

  • Safety and tolerability assessment:

    • Evaluation of potential hypersensitivity reactions

    • Monitoring for adverse immune activation

    • Long-term effects on immune homeostasis

This comprehensive approach would build on findings that L. lactis subsp. cremoris YRC3780 can enhance gene expression involved in Treg induction in mesenteric lymph node DCs and regulate the balance of T cell subsets , potentially leveraging these immunomodulatory properties for therapeutic applications while accounting for the additional effects of PmrA homolog expression.

How can transcriptomic and proteomic approaches be integrated to understand the broader impact of PmrA homolog expression in recombinant L. lactis systems?

Integrating transcriptomic and proteomic approaches provides a comprehensive understanding of how PmrA homolog expression affects recombinant L. lactis systems:

  • Experimental design for integrated -omics:

    • Parallel sample processing for RNA and protein extraction

    • Time-course analysis following PmrA induction

    • Comparison between wild-type, PmrA-expressing, and PmrA-knockout strains

    • Analysis under different stress conditions (antibiotic exposure, pH, temperature)

  • Transcriptomic methodologies:

    • RNA-Seq for global transcriptome profiling

    • qRT-PCR validation of key differentially expressed genes

    • Small RNA sequencing to identify regulatory ncRNAs

    • Ribosome profiling to assess translational efficiency

  • Proteomic approaches:

    • Shotgun proteomics for global protein identification

    • Targeted proteomics for PmrA interacting partners

    • Post-translational modification analysis

    • Membrane proteomics focusing on transport systems

  • Integrated data analysis:

    • Correlation analysis between transcript and protein levels

    • Pathway enrichment analysis across both datasets

    • Network analysis to identify regulatory hubs

    • Integration with metabolomic data when available

  • Functional validation strategies:

    • Mutational analysis of identified genes/proteins

    • Protein-protein interaction verification (co-IP, FRET)

    • Reporter gene fusions to validate regulatory connections

    • Phenotypic assays based on -omics predictions

  • Data integration framework:

    Integration LevelMethodsOutputs
    Primary data correlationSpearman/Pearson correlationGene-protein expression relationships
    Pathway mappingKEGG, GO enrichmentAffected biological processes
    Network reconstructionWeighted correlation networksRegulatory modules and hubs
    Causal inferenceBayesian networksDirectional influence networks
    Multi-omics clusteringSelf-organizing maps, NMFCo-regulated gene-protein clusters
  • Application-specific analyses:

    • Stress response mapping: Identify how PmrA expression alters global stress responses

    • Metabolic impact assessment: Determine effects on central metabolism and energy production

    • Secretion system analysis: Evaluate changes in protein secretion machinery

    • Cell surface modifications: Identify alterations to cell surface proteins and structures

This integrated approach would reveal how PmrA homolog expression extends beyond simple drug efflux to potentially affect global cellular physiology, similar to how researchers used microarray analyses to understand the effects of L. cremoris YRC3780 on CD4+ T cell gene expression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.