Recombinant Lactococcus lactis subsp. cremoris Multidrug resistance ABC transporter ATP-binding and permease protein (lmrA)

Shipped with Ice Packs
In Stock

Description

Biological Function and Mechanism

LmrA confers multidrug resistance by extruding cytotoxic compounds via ATP hydrolysis, functioning as a "hydrophobic vacuum cleaner" that removes lipophilic drugs from the membrane bilayer . Key mechanistic insights include:

  • ATP-Driven Transport: LmrA operates via an alternating two-site transport mechanism, where ATP binding/hydrolysis induces conformational changes to shuttle substrates across the membrane .

  • Substrate Specificity: Transports cationic amphiphiles (e.g., ethidium, Hoechst 33342) and antibiotics (e.g., erythromycin, tetracycline) .

  • Ion Coupling: Utilizes Na+/H+ gradients to enhance drug efflux, with residues E314 and N137 critical for ion coordination .

Functional Characteristics:

ParameterObservation
ATPase Activity1.2 µmol/min/mg (stimulated by drugs like daunomycin)
Drug Binding SitesTwo sites: high-affinity (inner membrane) and low-affinity (outer membrane)
InhibitionVanadate-sensitive (IC₅₀: 50 µM)

3.1. Functional Homology to Human P-Glycoprotein

LmrA shares 32% sequence identity with the human P-glycoprotein (ABCB1) and rescues drug-sensitive mammalian cells, validating its use as a prokaryotic model for studying multidrug resistance .

3.2. Conformational Dynamics

Pulsed electron-electron double resonance (PELDOR) spectroscopy revealed that ATP binding reduces conformational flexibility, stabilizing the transporter in an outward-facing state . Key observations:

  • Apo State: High structural flexibility (distance distribution: 3.5–5.5 nm between transmembrane helices).

  • ATP-Bound State: Fixed orientation (distance: 4.2 nm), enabling substrate occlusion .

3.3. Lipid Interaction

Reconstituted LmrA transports fluorescent phosphatidylethanolamine (PE) but not phosphatidylcholine (PC), suggesting a role in lipid homeostasis .

3.4. Ion-Dependent Transport

  • Na+ Stimulation: Ethidium efflux increases 3-fold in the presence of Na+ (Km: 5 mM) .

  • Proton Coupling: ΔpH drives electrogenic H+/drug antiport (n ≥ 2) .

4.1. ATP-Binding Domain (PDB: 1MV5)

The crystal structure of the LmrA ATP-binding domain (residues 221–590) at 3.1 Å resolution highlights:

  • ATP/ADP Binding: Coordinated via Walker A (GXXGXGKS/T) and Walker B (ΦΦΦΦD) motifs .

  • Dimer Interface: Stabilized by hydrogen bonds between K388 and D120 (critical for ATPase activity) .

4.2. Critical Mutations

MutationEffect
K388MAbolishes ATPase activity and ethidium transport
E314ADisrupts Na+ binding, reducing drug resistance 10-fold
N137AImpairs Cl− coordination, halting proton efflux

Applications and Implications

  1. Drug Resistance Studies: LmrA serves as a model for understanding ABC transporter-mediated multidrug resistance in pathogens .

  2. Biotechnological Tool: Used in L. lactis for efflux engineering to enhance microbial tolerance in industrial fermentation .

  3. Therapeutic Target: Screening inhibitors of LmrA could reverse antibiotic resistance in Gram-positive bacteria .

Controversies and Limitations

  • Substrate Discrepancies: While LmrA transports Hoechst 33342 in vitro, overexpression in L. lactis paradoxically increases cellular drug uptake, suggesting context-dependent functionality .

  • Physiological Role: Despite in vitro drug transport, lmrA knockout strains show no significant drug sensitivity, implying redundant efflux systems .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lmrA; llmg_1856; Multidrug resistance ABC transporter ATP-binding and permease protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-590
Protein Length
full length protein
Species
Lactococcus lactis subsp. cremoris (strain MG1363)
Target Names
lmrA
Target Protein Sequence
MERGPQMANRIEGKAVDKTSIKHFVKLIRAAKPRYLFFVIGIVAGIIGTLIQLQVPKMVQ PLINSFGHGVNGGKVALVIALYIGSAAVSAIAAIVLGIFGESVVKNLRTRVWDKMIHLPV KYFDEVKTGEMSSRLANDTTQVKNLIANSIPQAFTSILLLVGSIIFMLQMQWRLTLAMII AVPIVMLIMFPIMTFGQKIGWTRQDSLANFQGIASESLSEIRLVKSSNAEKQASKKAEND VNALYKIGVKEAVFDGLMSPVMMLSMMLMIFGLLAYGIYLISTGVMSLGTLLGMMMYLMN LIGVVPTVATFFTELAKASGSTGRLTELLDEEQEVLHQGDSLDLEGKTLSAHHVDFAYDD SEQILHDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIGGQPIDSVSLEN WRSQIGFVSQDSAIMAGTIRENLTYGLEGNFTDEDLWQVLDLAFARSFVENMPDQLNTEV GERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQRALDSLMKGRTTLV IAHRLSTIVDADKIYFIEKGEITGSGKHNELVATHPLYAKYVSEQLTVGQ
Uniprot No.

Target Background

Function

This protein functions as an efflux transporter for a variety of amphiphilic cationic compounds, including antibiotics.

Database Links
Protein Families
ABC transporter superfamily, Multidrug exporter LmrA (TC 3.A.1.117.1) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structural organization of LmrA?

LmrA is an ATP-binding cassette (ABC) transporter in Lactococcus lactis that functions as a homodimer. Each monomer consists of six putative transmembrane segments (TMS) and a nucleotide binding domain. The two membrane domains work together to form the solute translocation pathway across the membrane. Structurally, LmrA shares significant homology with the mammalian multidrug resistance (MDR) P-glycoprotein .

The transmembrane domains of LmrA form a unique aqueous chamber within the membrane that, under non-energized conditions, is open to the intracellular environment. This structural arrangement is critical for understanding how LmrA facilitates substrate transport. Cysteine scanning accessibility studies have confirmed the presence of six TMSs in each monomeric half of the transporter, with certain membrane-spanning α-helices (particularly TMS 6) having one face exposed to an aqueous cavity along their full length .

How does LmrA mediate multidrug transport?

LmrA functions through an ATP-dependent mechanism to transport a broad range of structurally unrelated amphiphilic drugs across the bacterial membrane. The transport process begins with substrate binding within the transmembrane domains, followed by ATP binding at the nucleotide binding domains, which induces conformational changes that facilitate substrate translocation .

Studies with reconstituted LmrA in proteoliposomes have demonstrated that the transporter catalyzes the ATP-dependent transport of fluorescent substrates such as Hoechst-33342. Importantly, this transport activity occurs in the absence of any accessory proteins, confirming that LmrA activity is independent of additional cellular components. The transport activity of LmrA extends beyond conventional drug substrates to include certain phospholipids, specifically fluorescent phosphatidylethanolamine, but not fluorescent phosphatidylcholine. This selective lipid transport capability suggests LmrA may have an additional physiological role in transporting specific lipids or lipid-linked precursors in L. lactis .

What structural features distinguish LmrA from other ABC transporters?

Unlike many ABC transporters that require accessory proteins for function, LmrA operates as a fully autonomous functional unit. Cysteine scanning experiments have revealed several unique structural features of LmrA. Most notably, the transmembrane domains form an aqueous chamber within the membrane that is open to the intracellular environment when the transporter is not energized .

The accessibility studies of TMS 6 (residues 291 to 308) showed a clear periodicity pattern indicating that this membrane-spanning α-helix has one face entirely exposed to an aqueous cavity. Additionally, 11 out of 15 membrane-embedded aromatic residues were found to be solvent-accessible, which is unusual for transmembrane proteins and highlights the unique architecture of LmrA's substrate translocation pathway .

What are the optimal expression systems for LmrA production?

For functional expression of LmrA, a nisin-inducible expression system in L. lactis has proven highly effective. This approach utilizes the tightly regulated nisA promoter, which is particularly advantageous for cytotoxic proteins like LmrA. Using this system, researchers have achieved functional overexpression of LmrA up to approximately 30% of total membrane protein, providing sufficient material for purification and subsequent studies .

The expression system involves several critical components:

ComponentPurposeOptimization Notes
nisA promoterTightly regulated expressionInduction timing affects protein yield
L. lactis hostNative environment for proper foldingPreferred over E. coli for functional expression
N-terminal histidine tagFacilitates purificationDoes not interfere with transport function
Induction conditionsControl expression levelOptimal induction at mid-log phase

This expression strategy addresses the challenges often encountered with membrane proteins, particularly those involved in multidrug transport, which can be toxic when overexpressed in heterologous systems .

How can LmrA be purified while maintaining functional activity?

A robust purification protocol for LmrA involves solubilization with dodecylmaltoside followed by nickel-chelate affinity chromatography. For this approach, introducing a histidine tag at the N-terminus of LmrA is essential to facilitate purification while preserving functional integrity .

The purification process includes these critical steps:

  • Membrane isolation from L. lactis cells overexpressing His-tagged LmrA

  • Solubilization of membrane proteins using dodecylmaltoside (typically 1% w/v)

  • Binding of solubilized His-tagged LmrA to nickel-chelate affinity resin

  • Washing to remove non-specifically bound proteins

  • Elution of purified LmrA using imidazole gradient

  • Buffer exchange to remove imidazole for downstream applications

Throughout this process, maintaining an appropriate detergent concentration above the critical micelle concentration is essential to prevent protein aggregation while preserving the native conformation necessary for transport activity .

What methods can be used to study LmrA's transmembrane structure?

Cysteine scanning accessibility is a powerful approach for investigating the transmembrane structure of LmrA. This method involves systematically replacing individual amino acids with cysteine residues and then assessing their accessibility to thiol-reactive reagents .

The methodology includes:

  • Generation of a cysteine-less LmrA variant as a background construct

  • Introduction of single cysteine residues at positions of interest

  • Expression of the single-cysteine mutants in L. lactis

  • Treatment with thiol-reactive reagents such as fluorescein maleimide or N-ethylmaleimide

  • Analysis of labeling patterns to determine solvent accessibility

  • Assessment of functional impact through transport assays

In one comprehensive study, 41 single cysteine mutants were constructed, targeting each hydrophilic loop, TMS 6, and all membrane-embedded aromatic residues. This approach revealed that most of these mutants retained drug transport capabilities, with only three mutants (F37C, M299C, and N300C) showing complete inactivation. Additionally, N-ethylmaleimide modification blocked transport activity in five mutants (S132C, L174C, S206C, S234C, and L292C), providing insights into residues critical for function .

How can LmrA be functionally reconstituted in proteoliposomes?

Functional reconstitution of LmrA into proteoliposomes is essential for studying its transport mechanism in a controlled environment. The recommended protocol involves:

  • Preparation of preformed liposomes from L. lactis phospholipids

  • Destabilization of liposomes with dodecylmaltoside

  • Addition of purified LmrA solubilized in dodecylmaltoside

  • Removal of detergent by adsorption onto polystyrene beads

  • Verification of successful reconstitution through freeze-fracture electron microscopy

  • Confirmation of functionality through ATP-dependent transport assays

This reconstitution approach has successfully demonstrated ATP-dependent transport of Hoechst-33342 into proteoliposomes containing LmrA. The same system also revealed LmrA's capacity to transport fluorescent phosphatidylethanolamine but not fluorescent phosphatidylcholine, highlighting the transporter's substrate selectivity .

To verify successful reconstitution, researchers typically assess:

ParameterMethodExpected Result
Protein incorporationSDS-PAGE analysisLmrA band present in proteoliposomes
OrientationProtease accessibilityAsymmetric distribution (preferably right-side-out)
ATP bindingATP photolabelingSpecific labeling of LmrA
Transport activityFluorescence-based assaysATP-dependent accumulation of substrates

What is the significance of the aqueous chamber in LmrA's transport mechanism?

The discovery of an aqueous chamber within the transmembrane domains of LmrA represents a significant finding with important mechanistic implications. Cysteine accessibility studies revealed that under non-energized conditions, LmrA forms an aqueous chamber within the membrane that is open to the intracellular environment .

This chamber is characterized by:

  • Unrestricted accessibility to bulky reagents like fluorescein maleimide

  • One face of TMS 6 being fully exposed to an aqueous cavity along its entire length

  • Solvent accessibility of 11 out of 15 membrane-embedded aromatic residues

These findings suggest that the chamber serves as a substrate-binding pocket that undergoes conformational changes during the transport cycle. The aqueous nature of this chamber likely facilitates the binding of diverse hydrophobic and amphiphilic substrates, explaining LmrA's broad substrate specificity. During the transport cycle, ATP binding and hydrolysis are thought to induce conformational changes that alter the accessibility of this chamber, transitioning from inward-facing to outward-facing states to enable substrate translocation across the membrane .

How do aromatic residues contribute to LmrA's substrate specificity?

Contrary to expectations, aromatic residues in the transmembrane regions of LmrA do not appear to be critical for substrate binding or transport. Systematic mutation of each membrane-embedded aromatic residue to cysteine revealed that most of these mutants retained drug transport capability. Out of 15 aromatic residue mutants, only one (F37C) was inactive, suggesting that individual aromatic residues are not essential for substrate recognition .

This finding contrasts with other multidrug transporters where aromatic residues often play crucial roles in substrate binding through π-π interactions or cation-π interactions with substrates. Instead, LmrA may rely on a more distributed binding mechanism involving multiple residues that collectively create a suitable microenvironment for diverse substrates.

The solvent accessibility of 11 out of 15 membrane-embedded aromatic residues further suggests that these residues may line the aqueous chamber and contribute to its physicochemical properties rather than directly interacting with substrates. This distributed binding mechanism could explain LmrA's ability to transport structurally unrelated compounds, as it doesn't depend on specific interactions with individual residues .

What structural changes occur in LmrA during the transport cycle?

During the transport cycle, LmrA undergoes significant conformational changes that facilitate substrate translocation. Based on accessibility studies and functional analyses, a model of these changes includes:

  • In the resting state (non-energized), the transmembrane domains form an aqueous chamber open to the intracellular side

  • Substrate binding within this chamber triggers conformational changes

  • ATP binding to the nucleotide binding domains induces additional structural rearrangements

  • These changes alter the orientation of the chamber from inward-facing to outward-facing

  • The substrate is released to the extracellular environment

  • ATP hydrolysis resets the transporter to its initial conformation

The periodicity of fluorescein maleimide accessibility in TMS 6 provides evidence for the helical structure of this segment and its role in forming the transport pathway. The pattern of accessibility suggests that one face of this helix is consistently exposed to an aqueous environment, while the opposite face may interact with neighboring helices or membrane lipids .

What is the relationship between LmrA and phospholipid transport?

An intriguing aspect of LmrA function is its ability to transport certain phospholipids, suggesting a potential physiological role beyond drug efflux. Reconstituted LmrA has been shown to catalyze the ATP-dependent transport of fluorescent phosphatidylethanolamine, but not fluorescent phosphatidylcholine, indicating substrate selectivity even among phospholipids .

This phospholipid transport activity may have significant implications:

  • LmrA could function as a flippase, translocating specific phospholipids across the membrane

  • It might be involved in membrane biogenesis and phospholipid distribution

  • The transporter could participate in removing toxic lipid products from the membrane

  • It may transport lipid-linked precursors involved in cell wall biosynthesis

The selective transport of phosphatidylethanolamine but not phosphatidylcholine suggests that LmrA recognizes specific structural features of phospholipids, possibly related to headgroup size, charge, or hydrogen-bonding capacity. This selectivity contrasts with its broad specificity for drug substrates and indicates that LmrA may have evolved multiple substrate recognition mechanisms .

What common challenges arise when expressing LmrA and how can they be addressed?

Expression of membrane proteins like LmrA presents several challenges that researchers should anticipate and address:

ChallengeCauseSolution
Low expression levelsToxicity to host cellsUse tightly regulated promoters (e.g., nisA)
Protein misfoldingImproper membrane insertionExpress in native L. lactis rather than E. coli
AggregationHydrophobic transmembrane domainsOptimize detergent type and concentration
Loss of functionImproper folding or modificationVerify function before and after purification
Expression of truncated proteinsPremature terminationOptimize codon usage and growth conditions

The use of the nisin-inducible expression system in L. lactis offers significant advantages for addressing these challenges. This system provides tight regulation, allowing controlled expression that minimizes toxicity while maximizing yield. Additionally, expressing LmrA in its native host ensures proper folding and membrane insertion, which can be problematic in heterologous systems .

How can researchers verify the functional integrity of purified and reconstituted LmrA?

Verifying the functional integrity of purified and reconstituted LmrA is critical for ensuring reliable experimental results. Multiple complementary approaches should be employed:

  • ATP binding assays using radiolabeled ATP or ATP analogs

  • ATPase activity measurements to confirm enzymatic function

  • Substrate binding assays using fluorescent substrates like Hoechst-33342

  • Transport assays measuring ATP-dependent substrate accumulation in proteoliposomes

  • Comparison of kinetic parameters with those reported in literature

For transport assays specifically, researchers should monitor the ATP-dependent accumulation of fluorescent substrates like Hoechst-33342 in proteoliposomes containing reconstituted LmrA. Control experiments should include:

  • Assays without ATP to establish baseline

  • Addition of non-hydrolyzable ATP analogs to distinguish between ATP binding and hydrolysis effects

  • Use of ATP regenerating systems for extended assays

  • Comparison with proteoliposomes containing inactive LmrA mutants

These controls help distinguish genuine transport activity from non-specific binding or leakage, ensuring the validity of experimental findings .

What considerations are important when designing cysteine scanning experiments for LmrA?

Cysteine scanning accessibility is a powerful approach for structural analysis of LmrA, but requires careful experimental design:

  • Background construct selection: Create a cysteine-less LmrA variant that retains transport activity as the foundation for introducing single cysteines. Verify that this construct maintains wild-type-like function before proceeding.

  • Strategic selection of positions: Target positions throughout the protein structure, including transmembrane segments, loops, and domains of interest. For LmrA, examining hydrophilic loops, TMS regions, and aromatic residues has provided valuable insights .

  • Reagent selection: Choose appropriate thiol-reactive reagents based on experimental goals:

    • Membrane-impermeable reagents (e.g., fluorescein maleimide) to probe surface accessibility

    • Reagents of different sizes to assess pore dimensions

    • Reagents that affect function (e.g., N-ethylmaleimide) to identify functionally important residues

  • Control experiments: Include:

    • Negative controls with cysteine-less LmrA

    • Positive controls with cysteines in known accessible positions

    • Conditions that alter conformational states (e.g., with/without nucleotides)

  • Functional validation: For each cysteine mutant, verify:

    • Expression levels comparable to wild-type

    • Proper membrane localization

    • Transport activity before and after labeling

These considerations ensure that cysteine scanning experiments provide reliable structural information while minimizing artifacts .

How can researchers distinguish between direct substrate transport and indirect effects in LmrA studies?

Distinguishing direct substrate transport from indirect effects is crucial for accurate interpretation of LmrA experiments:

  • Use purified, reconstituted systems: Working with purified LmrA reconstituted into proteoliposomes eliminates potential confounding factors from other cellular components. This approach has confirmed that LmrA directly mediates ATP-dependent transport of substrates like Hoechst-33342 and fluorescent phosphatidylethanolamine .

  • Implement appropriate controls:

    • ATP-dependence: Compare transport with and without ATP

    • Substrate specificity: Test multiple substrates to establish patterns

    • Mutant controls: Use transport-deficient mutants (e.g., Walker A/B mutations)

    • Inhibitor studies: Test the effect of known ABC transporter inhibitors

  • Distinguish transport from binding: Transport involves movement across the membrane, while binding does not. Use techniques that can differentiate:

    • Inside-out vesicles versus right-side-out vesicles

    • Fluorescence quenching assays that detect substrate location

    • Compartment-specific labeling strategies

  • Quantitative analysis: Measure:

    • Transport kinetics (initial rates, time courses)

    • Concentration-dependence (Km, Vmax)

    • Energetics (ATP/substrate coupling ratios)

By implementing these approaches, researchers can confidently attribute observed effects to direct LmrA-mediated transport rather than indirect consequences of experimental manipulations or artifacts .

What structural studies would advance our understanding of LmrA's transport mechanism?

Despite significant progress in characterizing LmrA, several structural studies could further illuminate its transport mechanism:

  • High-resolution structural determination through X-ray crystallography or cryo-electron microscopy in different conformational states (apo, ATP-bound, substrate-bound)

  • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during the transport cycle

  • Single-molecule FRET studies to monitor real-time conformational dynamics

  • Molecular dynamics simulations based on structural data to model substrate pathways and protein flexibility

  • Cross-linking studies to capture transient interactions between transmembrane helices during transport

These approaches would build upon existing cysteine accessibility data to provide a more comprehensive understanding of how LmrA coordinates ATP hydrolysis with substrate translocation, potentially revealing novel targets for inhibitor development or engineering enhanced transport capabilities.

How might LmrA research contribute to addressing antimicrobial resistance?

As a bacterial multidrug transporter, LmrA research has significant implications for combating antimicrobial resistance:

  • Developing inhibitors that specifically target bacterial ABC transporters like LmrA could potentially restore antibiotic sensitivity in resistant organisms

  • Understanding the structural basis of multidrug recognition could inform the design of antibiotics that evade efflux

  • Comparative studies between LmrA and mammalian P-glycoprotein could reveal bacterial-specific features that could be exploited for selective targeting

  • The apparent role of LmrA in phospholipid transport suggests it might be involved in membrane homeostasis, potentially offering alternative targets for antimicrobial development

Further characterization of LmrA's physiological roles beyond drug efflux, particularly in phospholipid transport and potentially cell wall biogenesis, could reveal novel vulnerabilities in bacterial physiology that might be targeted by future antimicrobial strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.