Recombinant Lactococcus lactis subsp. cremoris Oligopeptide transport system permease protein oppB (oppB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Lactococcus lactis subsp. cremoris Oligopeptide Transport System Permease Protein OppB (OppB) is a membrane-bound component of the ATP-binding cassette (ABC) transporter responsible for importing oligopeptides (4–35 residues) into bacterial cells. This protein is critical for nutrient acquisition in L. lactis, enabling the uptake of peptides derived from proteolytic degradation of casein in dairy environments .

Gene and Protein Features:

  • Gene Name: oppB (conserved across Lactococcus species) .

  • Protein Role: Forms the transmembrane channel with OppC, facilitating peptide translocation .

  • Domain Architecture: Contains 6–12 transmembrane helices, typical of ABC transporter permeases .

Recombinant Production:

ParameterDetails
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells, Cell-Free Expression
Purity≥85% (verified by SDS-PAGE)
Expression ChallengesRequires co-expression with OppC, OppD, and OppF for functional reconstitution .

Mechanism of Action:

  • OppB partners with OppC to form the transmembrane pore, while OppD and OppF hydrolyze ATP to drive transport .

  • The Opp system exhibits broad substrate specificity, preferring hydrophobic residues at positions 4–6 of peptides .

Key Functional Data:

  • Peptide Length Specificity: Optimal transport for nonamers, but accommodates peptides up to 35 residues .

  • Binding Affinity: Higher affinity for peptides lacking glycine, proline, or negatively charged residues .

Mutational Studies:

  • OppB Knockout Strains: Fail to transport oligopeptides, confirming its indispensability .

  • Co-Expression Requirements: Functional OppB requires OppC for membrane integration .

Expression Optimization:

  • Host Strain Engineering: Overexpression in L. lactis NZ9000 using the nisin-inducible nisA promoter enhances yield .

  • Productivity: Achieves up to 12-fold higher OppB levels compared to wild-type strains .

Genomic and Evolutionary Context

  • Operon Structure: oppB resides in the oppDFBCA operon, often co-located with the peptidase gene pepO .

  • Subspecies Variation: L. lactis subsp. cremoris strains frequently carry plasmid-encoded opp operons, enhancing peptide utilization in dairy niches .

Industrial Relevance:

  • Dairy Fermentation: Critical for flavor development in cheese through peptide uptake and catabolism .

  • Biotechnology: Used as a model system for studying ABC transporters in Gram-positive bacteria .

Technical Hurdles:

  • Reconstitution Complexity: Requires simultaneous expression of OppB, OppC, OppD, OppF, and OppA for full activity .

  • Membrane Localization: Proper targeting in heterologous hosts (e.g., E. coli) often necessitates codon optimization .

Comparative Analysis of OppB Production Systems

Host SystemAdvantagesLimitations
E. coliHigh yield, cost-effective Poor membrane protein folding
L. lactisNative lipid environment, functional Lower expression levels
Cell-Free ExpressionRapid production, no viability concerns Limited scalability

Future Directions

  • Structural Studies: Cryo-EM analysis to resolve OppB-OppC interactions .

  • Metabolic Engineering: Leveraging CRISPR/Cas9 to enhance OppB expression in industrial L. lactis strains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on your location and purchase method. For specific delivery times, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
oppB; LACR_D19; Oligopeptide transport system permease protein OppB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Lactococcus lactis subsp. cremoris (strain SK11)
Target Names
oppB
Target Protein Sequence
MWKVIIRRILLMIPQLFILSILVFFFAKLMPGDPFSGLIGPHTDPHEVEALRRAAGLYDP WWEQYLRWLGNAIHGNLGMSYNLKEPVMTVIGHRAINTFWMSLLSVILTYLFAIPMSIVA ARNEGKWQDQLWLTYNSITFGIPPYVFYLLIIFIFGYSLNWFPTGGTVSPDAMGIIPVFF SKIYHMILPAFSLAVFGTVGIFTYFRSGILDEQTQDYVRTARAKGVKEKVIFRRHILRNA SLPIASNFGFVITGLLGGAIFAETIFGYPGLGQLFITSISGRDYSMITALILLNGFLGLL GALLSDIIMAMVDPRIRIQ
Uniprot No.

Target Background

Function
This protein is part of the binding-protein-dependent transport system for oligopeptides. It is likely responsible for translocating the substrate across the membrane.
Database Links

KEGG: llc:LACR_D19

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the oligopeptide transport system in Lactococcus lactis and what role does OppB play?

The oligopeptide transport system (Opp) in Lactococcus lactis is an ATP-driven transporter that belongs to the ATP-binding cassette (ABC) superfamily. This transport system consists of five proteins that work together to import oligopeptides into the bacterial cell . OppB functions as one of the transmembrane components of this system, serving as a permease protein that forms part of the channel through which oligopeptides pass across the cell membrane.

The complete Opp system typically consists of:

  • OppA: The substrate-binding protein

  • OppB and OppC: Transmembrane permease proteins

  • OppD and OppF: ATP-binding proteins that provide energy for transport

In L. lactis, this system is crucial for nutrient acquisition, as it enables the bacterium to import oligopeptides which are subsequently broken down by intracellular peptidases into amino acids for metabolism and biosynthesis .

How does inactivation of oppB affect the growth and viability of Lactococcus lactis?

Inactivation of oppB in Lactococcus lactis significantly impairs the bacterium's ability to utilize oligopeptides. Studies on similar systems have shown that oppB mutants exhibit substantially reduced growth compared to wild-type strains when oligopeptides are the primary nitrogen source.

Based on comparative studies with related bacteria, oppB mutants typically show:

  • <50% of wild-type growth yield when grown on specific dipeptides (e.g., Arg-Ile and Val-Ile)

  • 40% less growth than wild-type when tri-peptides are the nitrogen source

  • 30% less growth than wild-type when tetra-peptides are provided

What experimental approaches are most effective for expressing and purifying recombinant OppB from L. lactis subsp. cremoris?

For effective expression and purification of recombinant OppB from L. lactis subsp. cremoris, a multi-step approach is recommended:

Expression Systems:

  • Nisin-Controlled Gene Expression System: This system has proven effective for overexpression of transmembrane components like OppB. The system uses nisin as an inducer, allowing tight control of gene expression .

  • Histidine-Tagging Strategy: Including a His-tag in the recombinant OppB construct facilitates subsequent purification. For OppB, C-terminal tagging is often preferred to minimize interference with transport function .

Purification Protocol:

  • Cell growth and induction:

    • Grow L. lactis in M17 broth supplemented with 0.5% glucose at 30°C

    • Induce with appropriate nisin concentration (typically 1-10 ng/ml)

    • Harvest cells during mid-exponential phase (OD600 = 0.3-0.5)

  • Membrane fraction preparation:

    • Disrupt cells using French press or sonication in buffer containing 50 mM HEPES-KOH (pH 7.0), 100 mM KCl, 10% glycerol

    • Remove cell debris by low-speed centrifugation

    • Isolate membranes via ultracentrifugation (100,000 × g, 1 hour)

  • Protein solubilization and purification:

    • Solubilize membrane proteins using 1% n-dodecyl-β-D-maltoside

    • Purify using Ni-NTA affinity chromatography

    • Elute with imidazole gradient (50-300 mM)

    • Further purify by size exclusion chromatography if needed

Yield and purity assessments should be performed using SDS-PAGE and Western blotting with anti-His antibodies.

How does the structure of OppB compare between L. lactis and other bacterial species, and what are the functional implications?

OppB structural comparisons between L. lactis and other bacteria reveal important conservation and diversity patterns:

Structural Comparisons:

SpeciesOppB Length (aa)Identity to L. lactis OppBKey Structural Differences
L. lactis subsp. cremoris~300100%Reference protein
L. lactis MG1363~30091-92%Highly conserved transmembrane domains
Helicobacter pylori~300~30%More variability in Core domain
Other Gram-positive bacteria290-31025-40%Species-specific variations in loop regions

Functional Implications:

  • Conserved Regions: The high conservation (>90% identity) between different L. lactis strains suggests critical functional domains that cannot tolerate much variation .

  • Transmembrane Topology: OppB typically contains 5-6 transmembrane segments that form the channel for oligopeptide transport. These segments are highly conserved across species, as they are essential for maintaining channel structure.

  • Species-Specific Adaptations: Variations in loop regions and certain transmembrane domains likely reflect adaptations to different environmental niches and substrate preferences. For example, H. pylori OppB shows adaptations that allow it to transport a wider range of peptides compared to L. lactis OppB .

  • Homo/Heterodimer Formation: OppB functions in complex with OppC. The interface between these proteins contains conserved residues critical for proper complex formation and channel function .

These structural differences impact substrate specificity, transport efficiency, and potential for targeted inhibition, which are important considerations for researchers designing experiments involving recombinant OppB.

What in vitro membrane systems are most appropriate for studying OppB-mediated oligopeptide transport, and how should they be constructed?

Several in vitro membrane systems can be employed to study OppB-mediated oligopeptide transport, each with specific advantages:

1. Hybrid Membrane Vesicles:

  • Construction Methodology:
    a) Isolate right-side-out membrane vesicles from L. lactis strains overexpressing the Opp system
    b) Fuse these vesicles with liposomes containing encapsulated ATP regenerating system
    c) Optimize lipid composition (typically 3:1 phosphatidylethanolamine:phosphatidylglycerol) to ensure proper membrane fluidity

  • Advantages: Maintains native membrane environment; allows study of complete Opp system

  • Limitations: Variable reproducibility; high ATP hydrolysis rate may limit transport studies

2. Reconstituted Proteoliposomes with Purified Components:

  • Construction Methodology:
    a) Purify OppB and OppC transmembrane components via histidine-tagged constructs
    b) Reconstitute purified proteins into liposomes at protein:lipid ratio of 1:100 to 1:200
    c) Incorporate ATP-binding components (OppD and OppF)
    d) Encapsulate ATP regenerating system (ATP, creatine phosphate, creatine kinase)

  • Advantages: Defined composition; control over individual component concentrations

  • Limitations: Complex assembly; potential loss of native interactions

3. Planar Lipid Bilayers for Electrophysiological Studies:

  • Construction Methodology:
    a) Form planar lipid bilayers across aperture separating two chambers
    b) Incorporate purified OppB/OppC complex into bilayer
    c) Monitor channel activity using patch-clamp techniques

  • Advantages: Allows real-time monitoring of transport events at single-channel level

  • Limitations: Technically challenging; may not fully recapitulate in vivo transport

Experimental Considerations:

  • Use radiolabeled substrates (e.g., [³H]Leu-enkephalin) to monitor transport

  • Include appropriate controls: ATP-depleted vesicles, vesicles without Opp components

  • Measure ATP hydrolysis rates in parallel to correlate with transport activity

  • Consider the impact of membrane composition on transporter activity

The hybrid membrane vesicle system has shown promise, though challenges with reproducibility and ATP maintenance have been documented . For definitive mechanistic studies, the reconstituted proteoliposome system with purified components offers the most controlled experimental environment.

How can gene knockout and complementation studies be designed to effectively evaluate the function of oppB in L. lactis?

Designing rigorous gene knockout and complementation studies for oppB in L. lactis requires careful planning and appropriate controls:

Knockout Strategy:

  • Selection of Target Regions:

    • Design knockout constructs targeting conserved regions of oppB

    • Avoid regions that might affect expression of downstream genes in the operon

    • Use sequence alignments of multiple L. lactis strains to identify essential regions

  • Knockout Methods:

    • Homologous recombination approach:

      • Create plasmid containing antibiotic resistance marker flanked by oppB homologous regions

      • Transform into L. lactis and select recombinants on appropriate antibiotic media

      • Confirm gene disruption by PCR and sequencing

    • CRISPR-Cas9 approach:

      • Design sgRNA targeting oppB

      • Provide repair template with antibiotic resistance

      • Select transformants and verify editing

  • Verification of Knockouts:

    • PCR verification of correct integration

    • RT-PCR to confirm absence of oppB transcript

    • Western blot analysis to confirm absence of OppB protein

    • Whole genome sequencing to rule out off-target effects

Complementation Strategy:

  • Vector Selection:

    • Use nisin-inducible expression system (e.g., pNZ8048)

    • Consider copy number (high vs. low) based on expression needs

    • Include constitutive promoters for stable expression

  • Complementation Design:

    • Wild-type oppB under native promoter

    • oppB under inducible promoter with various induction levels

    • Versions with epitope tags for detection if needed

    • Site-directed mutants to assess function of specific residues

  • Controls:

    • Empty vector control

    • Complementation with non-functional oppB mutant

    • Trans-complementation with homologues (e.g., appB)

Phenotypic Analysis:

Assay TypeWild-typeΔoppB MutantComplemented StrainMethodology
Growth on oligopeptides++++++ to ++++++ to +++++Growth in defined media with oligopeptides as sole nitrogen source; measure OD600 over time
Peptide uptake++++++++++ to +++++Use radiolabeled peptides (e.g., [³H]Leu-enkephalin); measure cell-associated radioactivity
Bacteriocin sensitivitySensitivePotentially resistantRestored sensitivitySpot-on-lawn assays with various bacteriocins
Cross-resistance to antimicrobialsBaselinePotentially alteredRestored to baselineGrowth on media containing various antimicrobials (e.g., bacitracin, vancomycin)

A successful complementation should restore wild-type phenotypes in the knockout strain, confirming that observed phenotypes are directly attributable to oppB disruption rather than polar effects or secondary mutations .

What statistical approaches are most appropriate for analyzing peptide transport data in oppB mutants versus wild-type strains?

When analyzing peptide transport data comparing oppB mutants to wild-type strains, several statistical approaches should be considered based on the experimental design and data characteristics:

For Growth Curve Analysis:

  • Growth Rate Comparison:

    • Calculate exponential growth rates (μ) for each strain

    • Use two-way ANOVA to assess effects of strain (wild-type vs. mutant) and peptide type

    • Apply post-hoc tests (Tukey's HSD) for multiple comparisons

    • Report p-values with appropriate corrections for multiple testing

  • Area Under Curve (AUC) Analysis:

    • Calculate AUC for complete growth curves

    • Apply t-tests or ANOVA for comparisons across strains and conditions

    • Use non-parametric alternatives (Mann-Whitney U test) if normality assumptions are violated

For Transport Assay Data:

  • Kinetic Parameter Estimation:

    • Fit Michaelis-Menten models to obtain Km and Vmax values

    • Compare parameters using extra sum-of-squares F test

    • Calculate 95% confidence intervals for each parameter

  • Time-Course Analysis:

    • Apply repeated measures ANOVA for time-course transport data

    • Consider mixed-effects models to account for random effects

    • Analyze initial rates using linear regression

Statistical Power Considerations:

Sample Size per GroupMinimum Detectable Effect Size (α=0.05, β=0.2)
32.87σ (very large effects only)
51.89σ (large effects)
81.41σ (medium-large effects)
121.12σ (medium effects)
200.84σ (medium-small effects)

σ represents standard deviation units

Dealing with Outliers and Variability:

  • Apply robust statistical methods (e.g., Welch's t-test) when variances differ between groups

  • Use bootstrapping approaches for non-normal data

  • Consider transformation (log, square root) for highly skewed data

  • Implement biological and technical replicates to assess variability sources

Regardless of the specific statistical approach, researchers should:

  • Clearly state hypotheses prior to analysis

  • Justify sample sizes based on power analysis

  • Report all data points, not just averages

  • Include appropriate visualizations (box plots, scatter plots with error bars)

  • Provide complete statistical details in methods section

How can researchers address contradictory data when analyzing the phenotypic effects of oppB mutations across different Lactococcus lactis strains?

Addressing contradictory data in oppB mutation studies across different L. lactis strains requires systematic evaluation of multiple factors:

Systematic Analysis Framework:

  • Strain Background Assessment:

    • Compare genomic contexts of oppB across strains (industrial vs. laboratory vs. wild strains)

    • Analyze presence of compensatory systems (e.g., DtpT, Dpp systems, App operon)

    • Sequence the complete opp operon to identify strain-specific variations

  • Mutation Characterization:

    • Determine if contradictory results stem from different mutation types:

      • Complete gene deletion vs. point mutations

      • Frameshift vs. missense mutations

      • Polar effects on downstream genes

  • Experimental Condition Differences:

    • Evaluate media composition variations (complex vs. defined)

    • Analyze growth conditions (temperature, pH, oxygen availability)

    • Consider growth phase at measurement (exponential vs. stationary)

Resolution Strategies:

  • Cross-Laboratory Validation:

    • Exchange strains between laboratories reporting contradictory results

    • Standardize experimental protocols across research groups

    • Perform identical experiments on multiple strains simultaneously

  • Comprehensive Phenotyping:

    • Expand phenotypic tests beyond growth to include:

      • Direct transport assays with labeled substrates

      • Proteomic analysis of oppB mutants vs. wild-type

      • Metabolomic profiling to detect metabolic adaptations

      • Stress response evaluation (acid, oxidative, osmotic stress)

  • Genetic Approaches to Resolve Contradictions:

    • Introduce identical mutations across strain backgrounds

    • Perform cross-complementation studies

    • Create isogenic strains differing only in oppB status

Case Study Analysis Table:

Study FindingPotential Explanation for ContradictionResolution Approach
oppB mutation abolishes peptide utilization in strain A but not strain BStrain B possesses functional appB homologueSequence appB in both strains; create appB/oppB double mutant
Growth defect on dipeptides in strain C but not on tripeptidesDifferent substrate specificity due to point mutations in permease domainCompare exact mutation locations; perform structure-function analysis
Inconsistent growth yields across studiesVariation in experimental conditions (media, temperature)Standardize conditions; perform parallel experiments
Variable bacteriocin resistance patternsDifferences in cell envelope composition between strainsAnalyze cell wall composition; measure membrane fluidity

When contradictions persist despite thorough investigation, researchers should:

  • Acknowledge limitations in current understanding

  • Present multiple working hypotheses

  • Propose specific experiments to address remaining contradictions

  • Consider strain-specific adaptations as biologically meaningful rather than experimental artifacts

The variability observed between strains may itself be informative, revealing the diversity of adaptation strategies in L. lactis and highlighting the complexity of oligopeptide transport systems in this species .

How can recombinant L. lactis expressing modified oppB be utilized for biotechnological applications such as delivery of bioactive peptides?

Recombinant L. lactis expressing modified oppB offers innovative approaches for bioactive peptide delivery systems:

Engineering Strategies:

  • OppB Modification Approaches:

    • Surface-display technology:

      • Create OppB fusion proteins with peptide-binding domains

      • Engineer specificity toward therapeutic peptides

      • Modify channel properties to improve uptake efficiency

    • Directional transport modification:

      • Engineer OppB to favor export rather than import

      • Create conditional expression systems (pH-responsive, site-specific)

  • Integrated Delivery Systems:

    • Co-express modified OppB with bioactive peptides

    • Combine with inducible lysis systems for controlled release

    • Engineer communication with host cells via quorum sensing modules

Biotechnological Applications:

  • Therapeutic Peptide Delivery:

    • Immunomodulatory peptides (e.g., p62 for inflammatory bowel disease)

    • Antimicrobial peptides for targeted pathogen inhibition

    • Metabolic regulators for diabetes management

    Example System: A recombinant L. lactis strain with modified OppB was used to deliver the p62 protein, which demonstrated anti-inflammatory properties by downregulating pro-inflammatory cytokines TNF and IFN-γ in a mouse colitis model .

  • Vaccine Development:

    • Antigen delivery to mucosal surfaces

    • Improved uptake of immunogenic peptides

    • Enhanced immune response through controlled persistence

  • Functional Food Applications:

    • Delivery of bioactive peptides in fermented foods

    • Enhanced nutrient bioavailability

    • Controlled release of flavor-enhancing peptides

Performance Metrics Table:

ApplicationTargetDelivery EfficiencyBiological EffectReference
Anti-inflammatoryp62 protein~60-70% delivery to intestinal mucosaDecreased MPO activity; downregulated TNF and IFN-γ
Probiotic enhancementPHB beads with surface functionalitiesAccumulation of up to 6% PHB of cellular dry weightFunctional display of bioactive proteins on granule surface
Metabolic engineeringCellooligosaccharide utilizationEfficient metabolism to L-LA in single-step fermentationGrowth on cellooligosaccharides up to cellooctaose

Implementation Challenges:

  • Stability and Expression:

    • Maintain plasmid stability without antibiotic selection

    • Balance expression levels to avoid cellular burden

    • Ensure proper membrane insertion of modified OppB

  • Regulatory Considerations:

    • Address GMO regulations for medical applications

    • Leverage GRAS (Generally Recognized As Safe) status of L. lactis

    • Design containment strategies for environmental release

  • Delivery Efficiency:

    • Optimize colonization and persistence in target tissues

    • Engineer acid and bile resistance for oral delivery

    • Improve targeting to specific cell types or tissues

The potential for recombinant L. lactis expressing modified oppB extends beyond traditional applications, opening new avenues for precision delivery of therapeutic peptides in both medical and food technology contexts .

What are the current methodological challenges in determining the three-dimensional structure of OppB and how might these be overcome?

Determining the three-dimensional structure of OppB presents several significant challenges due to its nature as a transmembrane protein:

Current Methodological Challenges:

  • Protein Expression and Purification:

    • Membrane proteins typically express at low levels

    • Detergent solubilization can destabilize native structure

    • Maintaining proper folding during purification is difficult

    • OppB requires association with OppC for optimal stability

  • Crystallization Barriers:

    • Detergent micelles complicate crystal packing

    • Conformational heterogeneity during transport cycle

    • Dynamic nature of transmembrane domains

    • Limited polar surface area for crystal contacts

  • NMR Limitations:

    • Size constraints (OppB/OppC complex ~60-70 kDa)

    • Relaxation properties affected by detergent micelles

    • Complex spectral patterns due to similar chemical environments in transmembrane helices

  • Cryo-EM Challenges:

    • Relatively small size of OppB for single-particle analysis

    • Contrast issues in detergent environments

    • Preferred orientation problems in vitreous ice

Innovative Approaches to Overcome Challenges:

  • Expression Strategies:

    • Utilize specialized expression hosts (e.g., C41/C43 E. coli strains)

    • Employ fusion partners to enhance expression and folding

    • Develop L. lactis-based expression systems that maintain native membrane environment

  • Stabilization Methods:

    • Screening lipid and detergent combinations systematically

    • Utilize nanodiscs or amphipols to maintain native-like environment

    • Generate conformationally locked mutants to reduce heterogeneity

    • Co-expression and co-purification with stabilizing partner proteins (OppC)

  • Advanced Structural Techniques:

    • Cryo-EM with Technological Enhancements:

      • Volta phase plates to improve contrast

      • Direct electron detectors for improved signal-to-noise

      • 3D classification to sort conformational states

      • Example success: Similar bacteriocin receptors have been resolved using this approach

    • X-ray Free Electron Laser (XFEL):

      • Microcrystals grown in lipidic cubic phase

      • Room temperature data collection avoiding radiation damage

      • Serial femtosecond crystallography for dynamic studies

    • Integrative Structural Biology:

      • Combine low-resolution cryo-EM maps with computational modeling

      • Validate with crosslinking mass spectrometry data

      • Use evolutionary coupling analysis to predict contacts

      • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Computational Approaches:

    • AlphaFold2 and RoseTTAFold for initial model generation

    • Molecular dynamics simulations in explicit membrane environments

    • Enhanced sampling techniques to explore conformational space

    • Comparative modeling based on related ABC transporters with known structures

Case Study - Success with Related Systems:

The related lactococcin A receptor, which belongs to the same transporter family, was successfully studied using cryo-EM, resulting in a structure at 3.0 Å resolution. This was achieved by:

  • Expressing the full complex (man-PTS) in L. lactis

  • Using GDN detergent for solubilization

  • Applying 3D classification to separate conformational states

  • The resulting structure revealed binding sites and conformational changes

These approaches could be adapted for OppB/OppC, potentially yielding crucial structural insights that would inform functional studies and enable structure-based engineering of this important transporter.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.