Recombinant Lactococcus lactis subsp. cremoris Oligopeptide transport system permease protein oppC (oppC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Lactococcus lactis subsp. cremoris Oligopeptide Transport System Permease Protein OppC

Recombinant Lactococcus lactis subsp. cremoris Oligopeptide transport system permease protein OppC (OppC) is a membrane-bound component of the ATP-binding cassette (ABC) transporter system responsible for importing oligopeptides into bacterial cells. This protein is critical for nitrogen acquisition, particularly in nutrient-scarce environments like milk, where L. lactis subsp. cremoris is widely used in dairy fermentations . The recombinant form is engineered for high-purity production in heterologous hosts such as E. coli or yeast, enabling biochemical and structural studies .

Recombinant Production

Recombinant OppC is typically produced with ≥85% purity using expression systems such as:

Host SystemPurityKey Features
E. coli≥85%Cost-effective, high yield
Yeast/Baculovirus≥85%Post-translational modifications
Cell-Free Expression≥85%Avoids host toxicity, suitable for NMR

Role in Proteolytic Systems

OppC is essential for nitrogen metabolism in L. lactis. Key findings include:

  • Peptide Uptake: The Opp system imports peptides generated by the extracellular proteinase PrtP, enabling L. lactis to thrive in milk by breaking down caseins .

  • Energy Efficiency: Hydrolysis of internalized peptides provides ATP via substrate-level phosphorylation, offsetting the energy cost of peptide import .

Transcriptional Regulation

  • CodY Repression: The opp operon (oppDFBCApepO) is regulated by CodY, which represses transcription under nitrogen-rich conditions .

  • Environmental Stress: Plasmid pBL1 in L. lactis downregulates celB (cellobiose transporter) but upregulates oppA and oppB, prioritizing nitrogen scavenging during bacteriocin production .

ConditionoppC Expression LevelSource
Nitrogen limitationUpregulated
Cellobiose metabolismDownregulated
UF-cheese environment0.2–0.3 (fold change)

Dairy Fermentation

  • Cheese Production: OppC enables L. lactis subsp. cremoris to efficiently utilize milk peptides, accelerating acidification and flavor development .

  • Strain Engineering: Overexpression of oppC enhances peptide uptake, improving fermentation kinetics in industrial settings .

Vaccine Development

Recombinant L. lactis strains expressing OppC-related systems have been engineered for mucosal vaccine delivery (e.g., HSV-1 glycoprotein D) . OppC’s role in nutrient uptake may indirectly enhance antigen presentation by sustaining bacterial viability in host environments .

Comparative Analysis with Homologs

OppC shares functional similarities with permeases in other bacteria but exhibits unique adaptations:

FeatureL. lactis subsp. cremoris OppCE. coli OppC
Substrate Size Range4–35 residues≤18 residues
Binding SpecificityBroad, hydrophobic preferenceNarrow, charged N/C termini
Host CompatibilityFunctional in Gram-positive systemsGram-negative specific
Data derived from .

Challenges and Future Directions

  • Structural Studies: Despite advances, the transmembrane topology of OppC remains unresolved. Cryo-EM or X-ray crystallography of recombinant OppC could clarify its role in substrate channeling .

  • Metabolic Engineering: Coupling OppC with peptide-secretion systems (e.g., PrtP) may optimize industrial peptide production .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly sent with blue ice packs. If you require dry ice shipment, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
oppC; LACR_D18; Oligopeptide transport system permease protein OppC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-294
Protein Length
full length protein
Species
Lactococcus lactis subsp. cremoris (strain SK11)
Target Names
oppC
Target Protein Sequence
MTEKKHKNSLSLVHSIKEELKKDKLAMISTIFLVAVFLIVYIYSMFLKQSNYVDVNIMDQ YLAPLTTGHLLGTDNGGRDIIMMLMISARNSFNIAFAVTLITLVVGNILGVITGYFGGRF DLIFMRFTDFVMILPSMMIIIVFVTIIPRFNSWSLIGIISIFSWIGTTRLIRARTMTEVN RDYVQASKTSGTSDFKIMFREIWPNLSTLVIAEATLVFAGNIGLETGLSFLGFGLPAGTP SLGTMINEATNPETMTDKPWTWVPATVVILIVVLAIIFIGNALRRVADQRQATR
Uniprot No.

Target Background

Function
This protein is part of the binding-protein-dependent transport system for oligopeptides. It is likely responsible for translocating the substrate across the membrane.
Database Links

KEGG: llc:LACR_D18

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lactococcus lactis and why is oppC protein significant for research?

Lactococcus lactis is a gram-positive, non-sporulating, non-motile bacterium that groups in pairs and short chains with typical cell lengths of 0.5-1.5 μm. It is extensively used in the production of dairy products including buttermilk and cheese due to its homofermentative metabolism that produces lactic acid from sugars. The bacterium has achieved significance in biotechnology as the first genetically modified organism used alive for treating human disease .

The oppC protein specifically functions as a permease component within the oligopeptide transport system of L. lactis. This transport system is crucial for nutrient uptake, particularly peptides, which are essential for bacterial growth and metabolism. The significance of oppC for research lies in its potential applications in protein delivery systems, vaccine development, and as a model for understanding membrane transport mechanisms in gram-positive bacteria .

What expression systems are commonly used for recombinant oppC protein production?

Recombinant oppC protein from Lactococcus lactis can be expressed using several heterologous expression systems. Based on the available research data, the most common expression platforms include:

  • Escherichia coli expression systems - These provide high yield but may require optimization for proper folding of membrane proteins

  • Yeast expression systems - Offer post-translational modifications that may better approximate native protein

  • Baculovirus expression systems - Useful for more complex protein structures

  • Mammalian cell expression systems - Provide the most sophisticated post-translational processing

How can researchers confirm the functional integrity of recombinant oppC protein?

Confirming the functional integrity of recombinant oppC protein requires a multi-faceted approach. Researchers should implement the following methodological steps:

  • Structural assessment: Utilize circular dichroism spectroscopy to verify the secondary structure composition, ensuring proper protein folding.

  • Membrane integration analysis: Employ fractionation studies followed by Western blot analysis to confirm proper membrane localization of the recombinant oppC, as it naturally functions as a membrane-embedded permease.

  • Transport activity assays: Develop reconstituted liposome systems containing purified oppC protein and measure the transport of labeled oligopeptides. A functional oppC should demonstrate selective transport capabilities consistent with its native role in peptide uptake.

  • Binding studies: Perform isothermal titration calorimetry or surface plasmon resonance to measure binding affinity to known oligopeptide substrates. The dissociation constants should align with published values for the native protein.

  • Comparative proteomics: Compare the peptide fingerprint of the recombinant protein with native oppC extracted from L. lactis to verify structural similarity .

These methodological approaches provide complementary data on both structural and functional aspects of the recombinant protein, ensuring that experimental findings will reflect the protein's natural biological activity.

What experimental design considerations are critical when studying oppC protein interactions with tumor suppression pathways?

When investigating oppC protein interactions with tumor suppression pathways, researchers must implement a carefully structured experimental design that accounts for multiple variables and potential confounding factors. Based on recent studies of Lactococcus lactis as a delivery vector for therapeutic proteins such as the tumor metastasis-inhibiting peptide KISS1, the following critical design considerations should be addressed:

  • Expression system optimization:

    • Select appropriate promoters for controlled expression levels in different microenvironments (e.g., tumor vs. normal tissue pH)

    • Implement inducible expression systems to modulate protein production timing

    • Design fusion constructs that preserve both oppC transport functionality and the bioactivity of tumor-suppressive cargo

  • In vitro model selection:

    • Utilize multiple cancer cell lines representing different tissue origins to account for heterogeneity in response

    • Implement both 2D and 3D culture systems to better approximate in vivo tumor architecture

    • Include appropriate normal cell controls to assess specificity of effects

  • Pathway analysis design:

    • Employ time-course experiments to capture transient signaling events

    • Use pharmacological inhibitors and genetic knockdowns to confirm pathway specificity

    • Implement comprehensive phosphoproteomic analysis to identify novel pathway connections

  • Delivery efficacy validation:

    • Quantify cellular uptake using fluorescently labeled constructs

    • Measure subcellular localization to confirm appropriate targeting

    • Assess functional outcomes through multiple complementary assays (proliferation, apoptosis, migration, invasion)

When designing experiments to test oppC as a delivery system for tumor-suppressing peptides like KISS1, researchers should implement controls that distinguish between the effects of the delivery system itself and the delivered cargo, as L. lactis has demonstrated intrinsic anti-tumor properties through exopolysaccharide production .

How should researchers address contradictory data regarding oppC protein function in different experimental contexts?

When confronting contradictory data regarding oppC protein function across different experimental systems, researchers should implement a systematic resolution approach that acknowledges the complexity of biological systems. Just as the same data plot can lead to different interpretations based on preconceived biases as demonstrated in recent contradiction studies , protein function data may vary based on experimental context.

A methodological framework for addressing contradictions includes:

  • Systematic parameter isolation:

    • Standardize protein preparation methods across laboratories

    • Test oppC function across a gradient of conditions (pH, temperature, ionic strength)

    • Document all experimental variables in a structured database to identify correlations with outcomes

  • Multi-institutional validation protocols:

    • Implement ring testing where identical samples and protocols are distributed to multiple laboratories

    • Establish consensus criteria for functional readouts

    • Develop standardized reference materials for calibration

  • Integrated data analysis approach:

    • Utilize Bayesian optimization techniques to develop probabilistic models of function

    • Apply machine learning algorithms to identify patterns in contradictory datasets

    • Implement orthogonal projection pursuit regression models to isolate key variables driving contradictions

  • Context-dependent functional classification:

    • Develop a matrix of oppC functional parameters across different conditions

    • Identify condition-specific cofactors that may modify protein behavior

    • Establish a formal ontology for describing context-dependent protein functions

Table 1: Framework for Resolving Contradictory Data in oppC Research

Resolution ApproachMethodologyExpected OutcomeValidation Metric
Parameter IsolationControlled variable experimentsIdentification of critical parametersReproducibility across systems
Multi-institutional ValidationRing testingConsensus benchmark valuesInter-laboratory correlation coefficient
Integrated Data AnalysisBayesian optimizationPredictive models of context-dependent functionPrediction accuracy in new contexts
Functional ClassificationContext-mappingComprehensive functional taxonomyReduction in reported contradictions

By employing this structured approach, researchers can transform contradictions from "signals of defeat" into "first steps in progress toward victory," as described by Whitehead . This methodology allows researchers to spiral closer to a unified understanding of oppC function across diverse experimental contexts.

What methodological approaches enable optimal recovery of functional oppC protein from different expression systems?

The recovery of functional oppC protein requires tailored methodological approaches depending on the expression system used. As a membrane-embedded permease protein, oppC presents unique challenges for maintaining structural integrity and functionality during purification. The following methodological approaches address system-specific optimization:

  • E. coli expression system recovery:

    • Implement gentle cell lysis using enzymatic methods (lysozyme treatment) rather than mechanical disruption

    • Utilize a staged solubilization approach with increasing detergent concentrations (0.5-2% n-dodecyl-β-D-maltoside) to optimize membrane protein extraction

    • Incorporate stabilizing additives (glycerol 10-20%, specific lipids) during purification to maintain native conformation

    • Apply affinity chromatography with extended binding times (4-6 hours) at reduced temperatures (4-8°C) to enhance yield while preserving function

  • Yeast expression system recovery:

    • Optimize spheroplasting conditions with zymolyase treatment prior to membrane isolation

    • Implement density gradient purification of membrane fractions before detergent extraction

    • Utilize mixed detergent systems (combination of non-ionic and zwitterionic detergents) for selective solubilization

    • Apply size exclusion chromatography as a final purification step to isolate monomeric vs. oligomeric forms

  • Baculovirus/insect cell system recovery:

    • Harvest cells at optimal post-infection timepoints (48-72 hours) before significant cell lysis occurs

    • Implement membrane fractionation through ultracentrifugation prior to solubilization

    • Utilize lipid nanodiscs for extraction to maintain native lipid environment

    • Apply cobalt-based affinity resins for higher specificity when using His-tagged constructs

The functional integrity of the recovered protein should be validated through transport assays in reconstituted proteoliposomes, measuring the uptake of fluorescently labeled oligopeptides. Importantly, researchers should implement quality control checkpoints throughout the purification process, including Western blot analysis with conformation-specific antibodies and circular dichroism spectroscopy to confirm retention of secondary structure elements critical for function.

How can researchers optimize heterologous expression systems for oppC protein production?

Optimizing heterologous expression systems for oppC protein requires a multifaceted approach addressing several critical parameters. For researchers working with this membrane permease protein, the following optimization strategy should be implemented:

  • Codon optimization strategies:

    • Analyze the codon usage bias between Lactococcus lactis and the host expression system

    • Design synthetic genes with codon adaptation index (CAI) values > 0.8 for the host organism

    • Eliminate rare codons particularly in the N-terminal region to enhance translation initiation

    • Avoid creating internal Shine-Dalgarno-like sequences that could disrupt translation

  • Expression vector optimization:

    • Select promoters with appropriate strength (moderate rather than high expression often yields better folding for membrane proteins)

    • Incorporate inducible systems (IPTG, tetracycline, or arabinose-inducible) with tunable expression levels

    • Include fusion partners that enhance membrane integration (e.g., mistic, GlpF) with cleavable linkers

    • Design constructs with purification tags positioned to minimize interference with membrane topology

  • Growth condition optimization:

    • Implement reduced temperature protocols (16-25°C) during induction to slow protein synthesis and improve folding

    • Add chemical chaperones (glycerol 5-10%, sorbitol 0.4-0.5M) to stabilize membrane proteins

    • Optimize media formulations with supplements supporting membrane synthesis (phospholipid precursors)

    • Use fed-batch cultivation with controlled growth rates (μ = 0.1-0.3 h⁻¹) to prevent formation of inclusion bodies

  • Post-translational processing considerations:

    • Co-express specific chaperones (GroEL/ES, DnaK) that assist membrane protein folding

    • Implement periplasmic targeting strategies for better disulfide bond formation when applicable

    • Consider specialized E. coli strains (C41/C43, Lemo21) designed for membrane protein expression

    • Monitor lipid composition of expression host and supplement with specific lipids if needed

By systematically optimizing these parameters through a Design of Experiments (DoE) approach, researchers can develop robust expression protocols that maximize both yield and functionality of the recombinant oppC protein.

What analytical techniques are most effective for studying the structure-function relationship of oppC protein?

Understanding the structure-function relationship of oppC protein requires the integration of multiple complementary analytical techniques. For researchers investigating this oligopeptide transport system component, the following analytical approaches provide the most comprehensive insights:

  • Structural analysis techniques:

    • Cryo-electron microscopy (Cryo-EM) at resolutions of 3-4Å to visualize the transmembrane topology and oligomeric assembly of oppC in its native lipid environment

    • X-ray crystallography following lipidic cubic phase crystallization to resolve atomic-level structural details of substrate binding sites

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational dynamics during substrate binding and transport

    • Solid-state NMR spectroscopy to analyze local structural changes in membrane-embedded regions under different substrate conditions

  • Functional characterization methods:

    • Substrate transport assays using purified oppC reconstituted into proteoliposomes with fluorescently labeled oligopeptides to measure transport kinetics

    • Electrophysiology (patch-clamp) recordings to measure substrate-induced ion conductance changes

    • Thermostability shift assays to quantify ligand-binding effects on protein stability

    • Surface plasmon resonance (SPR) to determine binding affinity constants for different substrates

  • Integrated computational-experimental approaches:

    • Molecular dynamics simulations parametrized with experimental structural data to model conformational changes during transport cycle

    • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) to measure distances between specific residues during substrate transport

    • Targeted molecular docking followed by experimental validation via mutagenesis of predicted binding residues

    • Evolutionary coupling analysis to identify co-evolving residues involved in allosteric regulation of transport

  • Structure-guided functional genomics:

    • Deep mutational scanning of binding pocket residues to establish comprehensive structure-function maps

    • Engineering chimeric transporters between oppC variants to identify domain-specific functions

    • In vivo complementation assays using oppC knockout strains to validate functional predictions from structural analysis

    • Ribosome profiling during oppC expression to identify translation pauses that may influence folding

The most effective research strategy integrates these techniques in an iterative manner, where structural insights guide functional experiments, and functional data informs refined structural studies. This bidirectional approach is particularly valuable for membrane proteins like oppC where traditional structural biology approaches face significant challenges.

How can researchers effectively troubleshoot expression and purification challenges specific to oppC protein?

When encountering challenges with oppC protein expression and purification, researchers should implement a systematic troubleshooting approach addressing the specific issues common to this membrane permease protein:

  • Low expression yield troubleshooting:

    • Problem: Toxic effects on host cells

    • Solution: Implement tightly regulated expression systems with minimal leaky expression; use specialized E. coli strains (C41/C43) engineered for toxic membrane protein expression

    • Validation: Monitor growth curves pre- and post-induction to confirm reduced toxicity

    • Problem: Poor translation efficiency

    • Solution: Optimize ribosome binding sites, eliminate rare codons, and adjust spacing between regulatory elements

    • Validation: Quantify mRNA levels via RT-qPCR to distinguish between transcriptional and translational issues

  • Protein misfolding troubleshooting:

    • Problem: Inclusion body formation

    • Solution: Reduce expression temperature to 16-20°C, add chemical chaperones (glycerol, sorbitol, betaine), co-express molecular chaperones (GroEL/ES, DnaK/J)

    • Validation: Compare membrane fraction vs. inclusion body fraction yields by Western blot

    • Problem: Improper membrane insertion

    • Solution: Add fusion partners that enhance membrane targeting (mistic, GlpF), optimize signal sequences, supplement growth media with phospholipids

    • Validation: Perform protease accessibility assays to confirm correct membrane topology

  • Purification-specific challenges:

    • Problem: Poor detergent extraction efficiency

    • Solution: Screen detergent panel (DDM, LMNG, CHAPS) at varying concentrations (0.5-2%) and temperatures (4-25°C)

    • Validation: Quantify protein recovery in soluble fraction using Western blot or activity assays

    • Problem: Protein aggregation during purification

    • Solution: Include stabilizing additives (glycerol 20%, cholesterol hemisuccinate), maintain consistent low temperature, add substrate ligands during purification

    • Validation: Monitor monodispersity using dynamic light scattering or size exclusion chromatography

  • Activity loss during purification:

    • Problem: Loss of essential lipids or cofactors

    • Solution: Supplement purification buffers with lipid mixtures mimicking native membrane, avoid harsh washing steps

    • Validation: Compare activity of protein purified using different protocols

    • Problem: Oxidation of critical residues

    • Solution: Include reducing agents (DTT, TCEP) and perform purification under nitrogen atmosphere when possible

    • Validation: Mass spectrometry analysis to detect oxidative modifications

Table 2: oppC Protein Troubleshooting Decision Matrix

Challenge CategoryCommon SymptomsFirst-line InterventionSecondary InterventionSuccess Indicator
Expression YieldOD600 plateaus after inductionLower induction temperatureSwitch to specialized host strain>1mg protein per liter culture
Protein FoldingMultiple bands on Western blotAdd chemical chaperonesCo-express molecular chaperonesSingle band at expected MW
Membrane InsertionProtein in cytoplasmic fractionOptimize signal sequenceAdd fusion partners>70% protein in membrane fraction
Detergent ExtractionLow recovery after solubilizationScreen detergent panelExtend extraction time>60% recovery of membrane protein
Protein StabilityPrecipitation during concentrationAdd stabilizing additivesMaintain strict temperature controlNo visible aggregation at 5mg/ml
Functional ActivityLow transport ratesAdd specific lipidsInclude substrate during purificationActivity comparable to native protein

This structured troubleshooting approach enables researchers to systematically identify and address the specific challenges associated with oppC protein, increasing the likelihood of obtaining functionally active protein for subsequent studies.

How can recombinant oppC protein be utilized in vaccine development research?

The application of recombinant oppC protein from Lactococcus lactis in vaccine development represents a promising research direction. Researchers can implement the following methodological approaches to utilize oppC in vaccine research:

  • Antigen delivery system development:

    • Engineer L. lactis strains expressing recombinant oppC fused to antigenic epitopes from pathogens

    • Design constructs where oppC serves as both a carrier protein and targeting molecule for antigen presentation

    • Optimize secretion signals to enhance antigen display on bacterial surface

    • Validate antigen presentation using immunofluorescence microscopy and flow cytometry

  • Mucosal immunity enhancement:

    • Exploit oppC's natural role in peptide transport to develop mucosal delivery systems

    • Design recombinant L. lactis strains with modified oppC to enhance uptake by M cells in gut-associated lymphoid tissue

    • Measure mucosal IgA production following administration of the engineered vaccine vectors

    • Conduct comparative studies against conventional delivery systems using standardized antigen models

  • Adjuvant property investigation:

    • Evaluate the intrinsic immunomodulatory properties of purified oppC protein

    • Test oppC as a fusion partner for weakly immunogenic antigens to enhance immune recognition

    • Characterize immune cell activation profiles (dendritic cells, macrophages) in response to oppC-antigen constructs

    • Determine optimal oppC concentration for balanced Th1/Th2 immune responses

  • Safety and efficacy assessment protocols:

    • Develop standardized protocols for evaluating biocontainment of recombinant L. lactis vaccines

    • Implement challenge studies in appropriate animal models with multiple readouts (antibody titers, cellular immunity, protection)

    • Establish comparative metrics against conventional vaccine platforms

    • Evaluate long-term persistence of immunity through structured time-course studies

Through these methodological approaches, researchers can leverage the unique properties of oppC protein and its native L. lactis host as a GRAS (generally recognized as safe) organism to develop novel vaccine platforms with particular advantages for mucosal delivery and enhanced safety profiles compared to more traditional vaccine vectors.

What are the methodological considerations for studying oppC protein interactions with tumor suppression pathways?

When investigating the role of oppC protein in tumor suppression pathways, particularly in the context of engineered Lactococcus lactis delivery systems, researchers should implement specific methodological approaches:

  • Design of recombinant oppC-tumor suppressor constructs:

    • Create fusion proteins linking oppC with tumor suppressor peptides (e.g., KISS1) with optimized linker sequences to preserve functionality of both components

    • Develop expression cassettes with tumor-specific promoters to enable conditional expression

    • Implement site-directed mutagenesis to modify the peptide binding pocket of oppC for enhanced tumor suppressor peptide transport

    • Validate construct integrity through sequencing and expression analysis in multiple cell types

  • Pathway analysis methodology:

    • Employ phosphoproteomic analysis to map activation of MAPK pathways following treatment with oppC-KISS1 constructs

    • Quantify NFκB binding to MMP-9 promoter using chromatin immunoprecipitation assays

    • Measure MMP-9 expression levels through RT-qPCR and zymography assays

    • Implement time-course experiments to capture signaling cascade dynamics

  • Functional outcome assessment:

    • Develop multi-parameter assays measuring cancer cell proliferation, apoptosis, and migration simultaneously

    • Implement 3D tumor spheroid models to better approximate in vivo conditions

    • Quantify dormancy induction using specialized cell cycle markers (p27, p21)

    • Measure changes in cancer stem cell populations using flow cytometry and limiting dilution assays

  • Comparative analysis framework:

    • Establish control groups including: wild-type L. lactis, L. lactis expressing non-functional oppC mutants, and direct application of tumor suppressor peptides

    • Create experimental matrices varying bacteria:tumor cell ratios, exposure times, and microenvironmental conditions

    • Develop standardized reporting metrics for anti-tumor effects to enable cross-study comparisons

    • Implement multivariate statistical models to distinguish between effects attributable to oppC, the bacterial carrier, and the delivered tumor suppressor peptide

Table 3: Experimental Design Matrix for oppC-Mediated Tumor Suppression Studies

Experimental VariableRange to TestMeasurement ParametersExpected Outcome Indicators
Bacteria:Tumor Cell Ratio1:1 to 100:1Cell viability, apoptotic indexDose-dependent response curve
Exposure Duration4h to 72hSignaling pathway activation kineticsTemporal activation pattern
Microenvironment pHpH 6.5-7.4Bacterial survival, peptide stabilityOptimal delivery conditions
Oxygen Tension1-21% O₂HIF-1α activation, oppC expressionHypoxia response profile
Co-treatment ConditionsChemotherapy agents at IC₂₀Synergy calculation (Chou-Talalay)Combination index values

This methodological framework enables researchers to systematically evaluate the potential of oppC-based systems for cancer therapy while distinguishing between the effects of the delivery system itself and the delivered tumor suppressor cargo. The research findings suggest that L. lactis expressing KISS1 can effectively downregulate MMP-9 expression through MAPK pathway activation and NFκB binding inhibition, leading to reduced cancer cell survival and metastasis .

How can computational approaches enhance oppC protein engineering for specific research applications?

Computational approaches offer powerful tools for engineering oppC protein with enhanced properties for specific research applications. Researchers should implement the following methodological framework to leverage computational tools effectively:

  • Structure-based computational design:

    • Utilize homology modeling with multiple templates to generate accurate structural models of oppC, particularly focusing on the substrate binding pocket

    • Implement molecular dynamics simulations (100ns-1μs) to identify conformational states relevant to transport cycle

    • Apply in silico alanine scanning to map energetically critical residues for substrate binding

    • Employ ensemble docking approaches against virtual libraries of peptides to predict binding specificity

  • Machine learning-guided mutation strategy:

    • Develop sequence-structure-function datasets from experimental characterization of oppC variants

    • Train supervised learning algorithms to predict functional outcomes of novel mutations

    • Implement deep mutational scanning data analysis to build comprehensive fitness landscapes

    • Design optimal mutation combinations using genetic algorithms or Bayesian optimization approaches

  • Pathway integration modeling:

    • Construct systems biology models incorporating oppC transport function within cellular metabolism

    • Simulate metabolic flux alterations resulting from engineered oppC variants

    • Predict emergent properties through integration of transport models with gene regulatory networks

    • Validate computational predictions through targeted metabolomic analysis

  • Application-specific optimization protocols:

    • For vaccine delivery: Optimize surface exposure of antigenic epitopes using epitope prediction algorithms and accessibility calculations

    • For tumor suppression: Model interaction interfaces between oppC and tumor suppressor peptides to maximize delivery efficiency

    • For metabolic engineering: Simulate substrate preference modifications to enhance uptake of specific peptides

    • For bioremediation: Screen substrate binding pocket modifications for enhanced binding of target compounds

These computational approaches should be implemented in an iterative design-build-test-learn cycle, where experimental validation informs refinement of computational models. A particularly effective strategy combines orthogonal projection pursuit regression models with experimental design to identify optimal protein variants with desired properties, as demonstrated in related optimization problems .

By integrating these computational approaches with experimental validation, researchers can significantly accelerate the development of oppC protein variants with enhanced properties for specific applications, reducing the experimental burden while increasing the probability of successful protein engineering outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.