Recombinant Lactococcus lactis subsp. cremoris Pantothenic acid transporter PanT (panT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand that you may have specific requirements. Please indicate your desired format during order placement, and we will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which serves as a reference point for your own protocols.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
panT; llmg_0542; Pantothenic acid transporter PanT; Pantothenic acid ECF transporter S component PanT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-196
Protein Length
full length protein
Species
Lactococcus lactis subsp. cremoris (strain MG1363)
Target Names
panT
Target Protein Sequence
MKKSKASDVAILAIFIAIMVVVQLFTQFVINVWPFPVKPTLLHLPVIIGSIILGWRKGAF LGLVWGLISFVTATIVTTPTSFLFSPFQPVIGTHHGSPWGLFIAFIPRILVGILPYFVYK IANNRLGAGLAAFAGTATNTVLVLTSIFLFFGSTLKWSLSYLLGAIVATNSLTEVIIAVI LTTAIVPALTKARNNS
Uniprot No.

Target Background

Function
PanT is likely a pantothenic acid-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike traditional ABC transporters, this ECF transporter provides the energy needed for the transport of a variety of substrates. Notably, these substrates are bound by transmembrane proteins, not extracytoplasmic soluble proteins.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the physiological role of the PanT transporter in Lactococcus lactis subsp. cremoris?

The PanT protein in L. lactis subsp. cremoris functions as a specialized transporter for pantothenic acid (vitamin B5), an essential nutrient required for coenzyme A biosynthesis. The 196-amino acid membrane protein belongs to the ECF (Energy-Coupling Factor) transporter S-component family, which facilitates the uptake of micronutrients in prokaryotes. PanT specifically mediates the high-affinity transport of pantothenic acid across the bacterial membrane, which is crucial for cellular metabolism as pantothenic acid serves as the precursor for coenzyme A, a central cofactor in numerous metabolic pathways including the citric acid cycle, fatty acid metabolism, and acetylation reactions .

The transporter exhibits structural features typical of membrane transporters, with multiple transmembrane domains creating a channel-like structure across the cytoplasmic membrane. The precise mechanism involves conformational changes that allow for substrate recognition, binding, and translocation into the cytoplasm. This transport process is energy-dependent, coupling with the ATP-binding components of the ECF transporter complex .

How does the structure of PanT relate to its function in pantothenic acid transport?

Based on sequence analysis and structural predictions, PanT consists of six transmembrane domains with both N- and C-termini located in the cytoplasm. The protein exhibits characteristic hydrophobic regions interrupted by short hydrophilic loops that contribute to the formation of a substrate-binding pocket specific for pantothenic acid .

Key structural elements include:

  • A central binding pocket formed by residues from multiple transmembrane helices

  • Conserved amino acid residues that interact directly with pantothenic acid

  • Conformationally flexible regions that facilitate the alternating access mechanism common to transporters

These structural features allow PanT to undergo conformational changes during the transport cycle, transitioning between outward-facing (able to bind extracellular pantothenic acid) and inward-facing (releasing substrate into the cytoplasm) states. Similar mechanisms are observed in other bacterial transporters belonging to the ECF transporter family.

How is PanT expression regulated in L. lactis subsp. cremoris?

PanT expression appears to be regulated by pantothenic acid availability through a mechanism similar to other nutrient transporters in bacteria. While specific regulatory elements controlling panT gene expression in L. lactis subsp. cremoris have not been fully characterized in the provided sources, comparative analysis with other bacterial systems suggests regulation likely involves:

  • Feedback inhibition by intracellular pantothenic acid or CoA levels

  • Potential riboswitch mechanisms in the 5' UTR of the mRNA

  • Transcriptional regulation by global nutrient-sensing regulatory proteins

Researchers investigating PanT regulation should consider examining the upstream genomic region for conserved regulatory elements, performing reporter gene assays under varying pantothenic acid concentrations, and analyzing transcriptomic profiles under different nutritional conditions.

What expression systems are optimal for producing recombinant L. lactis PanT protein?

The optimal expression system for recombinant PanT production depends on research objectives. The commercially available recombinant PanT is expressed in E. coli with an N-terminal His-tag . This approach offers several advantages:

  • High yield of protein expression

  • Well-established protocols for induction and harvest

  • Simplified purification via affinity chromatography

For researchers seeking alternative expression systems, consider:

Expression SystemAdvantagesChallengesBest For
E. coliHigh yield, simple genetic manipulation, cost-effectivePotential for inclusion body formation, lacks post-translational modificationsStructural studies, biochemical analysis
L. lactisNative environment, proper folding, potential for functional studiesLower yields, more complex genetic manipulationTransport activity studies, interaction analysis
Cell-free systemsRapid expression, avoids toxicity issuesExpensive, potentially lower yieldsPreliminary characterization, toxic protein variants

For optimal E. coli expression, consider using BL21(DE3) strains with pET vector systems under control of the T7 promoter. Membrane proteins like PanT may benefit from specialized E. coli strains engineered for membrane protein expression, such as C41(DE3) or C43(DE3) .

What purification strategies yield the highest purity and activity for recombinant PanT?

Purification of membrane proteins like PanT requires specialized approaches to maintain protein integrity and function. The recommended purification workflow includes:

  • Initial Extraction: Carefully extract membrane proteins using mild detergents (e.g., DDM, LDAO, or FC-12) that effectively solubilize membrane proteins while preserving their native structure.

  • Affinity Chromatography: Utilize the N-terminal His-tag for IMAC (Immobilized Metal Affinity Chromatography) purification with Ni-NTA resin. Optimize binding buffers to contain:

    • 20-50 mM Tris-HCl or phosphate buffer (pH 7.4-8.0)

    • 150-300 mM NaCl to reduce non-specific interactions

    • 0.02-0.05% detergent (below CMC)

    • 10-30 mM imidazole to reduce non-specific binding

  • Size Exclusion Chromatography (SEC): Further purify and analyze oligomerization state using columns such as Superdex 200.

  • Quality Assessment: Verify purity using SDS-PAGE (>90% purity expected) and consider Western blotting with anti-His antibodies.

For maintaining protein stability, include 5-10% glycerol in storage buffers and store aliquoted protein at -80°C to prevent repeated freeze-thaw cycles .

How can researchers verify the structural integrity and proper folding of recombinant PanT?

Verifying the structural integrity and proper folding of recombinant PanT is crucial for functional studies. Multiple complementary approaches should be employed:

  • Circular Dichroism (CD) Spectroscopy: Analyze secondary structure content of purified PanT. Alpha-helical membrane proteins typically show characteristic negative peaks at 208 and 222 nm.

  • Thermal Stability Assays: Monitor protein unfolding using differential scanning fluorimetry (DSF) or nanoDSF to assess stability in different buffer conditions.

  • Limited Proteolysis: Properly folded proteins show differential resistance to proteolytic digestion compared to misfolded variants.

  • Functional Assays: Ultimately, functional transport assays (e.g., proteoliposome-based transport assays with radiolabeled pantothenic acid) provide the most direct evidence of proper folding.

  • Microscale Thermophoresis (MST): Measure binding affinities between purified PanT and pantothenic acid to confirm substrate recognition capability.

Researchers should interpret these results collectively rather than relying on a single method to confirm proper folding and structural integrity.

What methodologies can be used to measure PanT transport activity in vitro?

Several methodologies can be employed to measure PanT transport activity in vitro, each with specific advantages:

  • Proteoliposome-Based Transport Assays: Reconstitute purified PanT into liposomes and measure uptake of radiolabeled (³H or ¹⁴C) pantothenic acid over time. This approach most closely mimics the natural membrane environment and allows for precise control of internal and external buffer compositions.

  • Membrane Vesicle Transport Assays: Prepare inside-out membrane vesicles from E. coli expressing recombinant PanT and measure substrate uptake. This method preserves the native membrane environment but offers less control over experimental conditions.

  • Fluorescence-Based Assays: Utilize fluorescent pantothenic acid analogs to monitor transport in real-time using fluorescence spectroscopy.

  • Electrophysiological Measurements: For detailed mechanistic studies, reconstitute PanT in planar lipid bilayers and measure substrate-induced currents.

  • Growth Complementation Assays: Employ S. enterica panB panS mutant strains, which rely on exogenous pantoate supply. Expression of functional PanT enhances growth when pantoate is supplied in the medium, providing a biological readout of transport activity .

For rigorous characterization, determine key kinetic parameters including Km, Vmax, and substrate specificity by varying pantothenic acid concentrations and measuring initial transport rates.

How does PanT in L. lactis compare functionally to pantothenic acid transporters in other bacterial species?

Comparative analysis of pantothenic acid transporters across bacterial species reveals important evolutionary and functional relationships:

OrganismTransporterFamilyKey Differences from L. lactis PanTReference
Salmonella entericaPanSECFHigher affinity for ketopantoate
E. coliPanFMFSNa⁺-independent; different structureN/A
B. subtilisPanTECFSimilar structure but different substrate specificityN/A

The BASS1 transporter in plants, while not directly homologous to bacterial PanT, represents a convergent evolutionary solution for pantothenate precursor transport, specifically mediating plastidial pantoate transport . This example illustrates how different protein families have evolved to fulfill similar metabolic requirements across diverse organisms.

What are the effects of point mutations on PanT transport activity and substrate specificity?

While comprehensive mutagenesis studies specifically on L. lactis PanT are not detailed in the provided references, structure-function relationships can be extrapolated from related transporters. Key residues likely critical for PanT function include:

  • Conserved charged residues in transmembrane domains: Likely involved in substrate recognition and binding

  • Hydrophobic residues lining the transport channel: Critical for creating the substrate pathway

  • Residues at the interface with other ECF transporter components: Important for coupling transport to energy input

Researchers investigating structure-function relationships should consider:

  • Alanine-scanning mutagenesis of conserved residues

  • Comparative mutagenesis based on homology models with related transporters

  • Site-directed mutagenesis of predicted substrate-binding residues

Mutations affecting substrate specificity would be particularly valuable for understanding the molecular basis of pantothenic acid recognition and for engineering variants with altered substrate preferences for biotechnological applications.

How can the PanT transporter be utilized in metabolic engineering applications?

The PanT transporter offers several strategic applications in metabolic engineering:

  • Enhanced Vitamin B5 Production: Overexpression of PanT in production strains can improve pantothenic acid uptake, potentially increasing CoA availability for biosynthetic pathways.

  • Development of Biosensors: PanT can be coupled with reporter systems to create biosensors for pantothenic acid or CoA levels, enabling high-throughput screening of production strains.

  • Nutrient-Controlled Gene Expression: The panT promoter region could serve as a regulatory element for controlling gene expression in response to pantothenic acid availability.

  • Improved Strain Robustness: Engineering PanT expression in industrial strains may enhance their ability to scavenge pantothenic acid from complex media, improving growth and production in suboptimal conditions.

  • Enhanced Probiotic Properties: Given the established gastrointestinal health benefits of L. lactis subsp. cremoris , engineering strains with optimized PanT expression could enhance their viability and probiotic effects in the gut environment.

These applications leverage PanT's natural function while integrating it into broader metabolic engineering strategies aimed at improving biochemical production or strain performance.

What role does PanT play in the development of L. lactis as a vaccine delivery system?

While not directly addressed in the search results, the potential role of PanT in L. lactis-based vaccine delivery systems can be inferred by connecting several findings:

  • L. lactis has been successfully engineered to express heterologous antigens, as demonstrated with avian H5N1 influenza haemagglutinin , indicating its value as a vaccine delivery vector.

  • Metabolic fitness of the delivery strain is critical for effective antigen production and immune system interaction. PanT, by ensuring efficient pantothenic acid uptake, contributes to the metabolic health of L. lactis.

  • For vaccine delivery applications, maintaining metabolic balance while expressing foreign antigens is challenging. Optimizing PanT expression could help maintain CoA levels necessary for energy metabolism despite the metabolic burden of recombinant antigen production.

  • The immunomodulatory properties of L. lactis subsp. cremoris, particularly its interaction with host TLR2 receptors , suggest that metabolically robust strains with optimized PanT function could serve as effective adjuvants, enhancing immune responses to co-delivered antigens.

Researchers developing L. lactis as vaccine vectors should consider the potential benefits of engineering PanT expression to optimize metabolic capacity while maintaining the beneficial immune-modulatory properties of the delivery strain.

What structural biology approaches are most suitable for determining the three-dimensional structure of PanT?

Determining the three-dimensional structure of membrane proteins like PanT presents significant challenges. Multiple complementary approaches should be considered:

  • X-ray Crystallography:

    • Requires generation of well-diffracting crystals

    • May employ lipidic cubic phase (LCP) crystallization

    • Consider fusion proteins (e.g., T4 lysozyme) to facilitate crystallization

    • Resolution typically between 2.0-3.5 Å for membrane proteins

  • Cryo-Electron Microscopy (Cryo-EM):

    • Increasingly powerful for membrane protein structure determination

    • Avoids crystallization challenges

    • Particularly effective for larger complexes (PanT with partner proteins)

    • Modern detectors and processing algorithms allow near-atomic resolution

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Solution NMR for smaller domains

    • Solid-state NMR for full-length protein in membrane mimetic environments

    • Provides dynamic information not available from static structures

  • Integrated Computational Approaches:

    • Homology modeling based on related transporters

    • Molecular dynamics simulations to explore conformational changes

    • AlphaFold2 and similar AI-based prediction tools

Each approach has strengths and limitations. A hybrid strategy combining experimental structural data with computational modeling will likely provide the most complete understanding of PanT structure and mechanism.

How can systems biology approaches integrate PanT function into whole-cell metabolic models?

Integrating PanT function into whole-cell metabolic models requires multi-level approaches:

  • Genome-Scale Metabolic Modeling:

    • Incorporate PanT as a specific reaction for pantothenic acid uptake

    • Constrain the model with experimentally determined transport kinetics

    • Use flux balance analysis (FBA) to predict the impact of PanT activity on global metabolism

  • Multi-Omics Data Integration:

    • Correlate transcriptomic data on panT expression with metabolomic profiles

    • Identify co-regulated genes that may function in related pathways

    • Map changes in CoA-dependent pathways when PanT activity is modulated

  • Regulatory Network Analysis:

    • Identify transcription factors controlling panT expression

    • Map the influence of pantothenic acid availability on global gene expression

    • Model feedback loops between CoA metabolism and PanT expression

  • Cell-Scale Kinetic Modeling:

    • Develop detailed kinetic models of pantothenic acid uptake and CoA biosynthesis

    • Integrate these with existing models of central metabolism

    • Simulate dynamic responses to changing environmental conditions

These integrated approaches would provide a comprehensive understanding of how PanT contributes to cellular homeostasis and metabolic adaptation in L. lactis.

What emerging technologies could advance our understanding of PanT regulation and function?

Several cutting-edge technologies hold promise for advancing PanT research:

  • CRISPR-Based Approaches:

    • CRISPRi for tunable repression of panT expression

    • CRISPR activation systems for controlled upregulation

    • CRISPR-based base editing for introducing specific point mutations without full gene disruption

  • Single-Cell Technologies:

    • Single-cell RNA-seq to capture heterogeneity in panT expression

    • Time-lapse microscopy with fluorescent reporters to monitor dynamic regulation

    • Microfluidic systems to control environmental conditions while monitoring single-cell responses

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize PanT localization in bacterial membranes

    • FRET-based sensors to monitor transport activity in living cells

    • Correlative light and electron microscopy to link function with ultrastructure

  • High-Throughput Functional Assays:

    • Deep mutational scanning to comprehensively map structure-function relationships

    • Massively parallel reporter assays to decode regulatory elements controlling panT expression

    • Automated transport assays for large-scale screening of conditions or inhibitors

These emerging technologies would dramatically expand our ability to interrogate PanT function at multiple levels, from atomic structure to whole-cell integration, advancing both basic understanding and applied biotechnological applications.

What are common challenges in working with recombinant PanT and how can they be addressed?

Researchers working with recombinant PanT commonly encounter several challenges:

  • Low Expression Yields:

    • Solution: Optimize codon usage for expression host, adjust induction conditions (temperature, inducer concentration, duration), and consider specialized strains for membrane protein expression

    • Alternative: Use fusion partners (MBP, SUMO) to enhance solubility and expression

  • Protein Aggregation During Purification:

    • Solution: Screen multiple detergents at concentrations above their critical micelle concentration (CMC), add stabilizers like glycerol (5-10%) or specific lipids

    • Diagnostic: Monitor aggregation by dynamic light scattering during purification steps

  • Loss of Activity After Purification:

    • Solution: Minimize purification steps, maintain constant detergent concentration, consider incorporating lipids during purification

    • Validation: Perform activity assays at multiple purification stages to identify problematic steps

  • Inconsistent Reconstitution into Liposomes:

    • Solution: Standardize proteoliposome preparation through careful control of protein:lipid ratios, detergent removal rates, and lipid composition

    • Quality control: Characterize proteoliposomes by freeze-fracture electron microscopy and dynamic light scattering

  • Non-specific Binding in Transport Assays:

    • Solution: Include proper controls (proteoliposomes without protein, heat-inactivated protein) and optimize washing procedures

    • Validation: Perform competition assays with excess unlabeled substrate

Addressing these challenges requires systematic optimization and careful documentation of experimental conditions to ensure reproducibility.

How can researchers accurately measure pantothenic acid concentrations in biological samples?

Accurate measurement of pantothenic acid in biological samples is essential for PanT research. Several methodological approaches are available:

  • Microbiological Assays:

    • Utilize pantothenic acid-dependent microorganisms (L. plantarum) whose growth correlates with pantothenic acid concentration

    • Advantages: Sensitive, detects bioavailable pantothenic acid

    • Limitations: Time-consuming, less specific

  • HPLC-Based Methods:

    • Reverse-phase HPLC with UV detection (290 nm) after sample preparation

    • Improved sensitivity through pre-column derivatization with o-phthalaldehyde

    • Typical detection limits: 0.1-0.5 μg/mL

  • LC-MS/MS Approaches:

    • Offers superior sensitivity and specificity

    • Can simultaneously quantify pantothenic acid and related metabolites

    • Detection limits potentially in the ng/mL range

    • Sample preparation typically involves protein precipitation and solid-phase extraction

  • Enzymatic Assays:

    • Coupled enzyme reactions converting pantothenic acid to measurable products

    • Can be adapted to plate-reader format for higher throughput

    • Commercial kits available but may require validation for specific sample types

  • Radiometric Methods:

    • For transport studies, radiolabeled [³H]pantothenic acid provides high sensitivity

    • Requires special handling and disposal procedures

    • Allows direct measurement of transport kinetics

Sample preparation is critical regardless of the analytical method chosen. For bacterial samples, rapid quenching of metabolism (cold methanol), efficient extraction, and removal of interfering compounds are essential steps for accurate quantification.

What controls should be included when studying PanT function in heterologous expression systems?

Rigorous experimental design for PanT functional studies should include multiple controls:

  • Expression Controls:

    • Empty vector control: Cells transformed with the expression vector lacking the panT gene

    • Inactive mutant control: Expression of a non-functional PanT variant (e.g., mutated in key residues)

    • Positive control: Expression of a well-characterized related transporter

  • Substrate Specificity Controls:

    • Structurally related compounds to test specificity

    • Competitive inhibition assays with unlabeled pantothenic acid

    • Transport assays with pantothenic acid analogs

  • System-Specific Controls:

    • For growth complementation: Verify that growth rescue is specifically due to PanT function and not indirect effects

    • For transport assays: Non-specific binding controls (e.g., boiled/denatured protein)

    • For proteoliposome studies: Liposomes without reconstituted protein

  • Experimental Validation Controls:

    • Technical replicates: Multiple measurements from the same biological sample

    • Biological replicates: Independent transformations or protein preparations

    • Time-course measurements to ensure linearity within the measurement range

  • Data Analysis Controls:

    • Appropriate statistical tests for significance

    • Multiple methods to calculate kinetic parameters

    • Comparison with published values for related transporters

Implementing these controls ensures that observed effects can be confidently attributed to PanT function rather than experimental artifacts or non-specific effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.