Recombinant Lactococcus lactis subsp. cremoris Queuosine precursor transporter QueT (queT)

Shipped with Ice Packs
In Stock

Description

Protein Overview

QueT is a component of the Energy-Coupling Factor (ECF) transporter family, which facilitates the uptake of queuosine precursors like PreQ1_1 (7-aminomethyl-7-deazaguanine) . The recombinant variant (UniProt ID: A2RM05) is derived from L. lactis subsp. cremoris strain MG1363 and includes a full-length sequence (1-169 amino acids) fused to an N-terminal His tag for purification .

Functional Role in Queuosine Biosynthesis

QueT mediates the import of PreQ1_1, a precursor modified into queuosine by tRNA-guanine transglycosylases . This process is regulated by PreQ1_1 riboswitches, which modulate queT expression in response to precursor availability . Key functional insights include:

  • Substrate Specificity: Exclusively transports PreQ1_1 derivatives .

  • Energy Coupling: Depends on the EcfAA′T module for ATP-driven transport .

  • Genomic Context: Colocalizes with queuosine synthesis genes in Firmicutes .

Expression System Optimization

Recombinant QueT is expressed in E. coli using the P170 promoter system, which is induced by lactate accumulation . This system avoids endotoxin contamination and secretes stable proteins into the growth medium .

Purification Protocol

  1. Lysis: Sonication in Tris/PBS buffer.

  2. Affinity Chromatography: Ni-NTA resin for His-tag purification.

  3. Storage: Lyophilized at -80°C with trehalose to prevent aggregation .

Research Applications

  • Mechanistic Studies: Elucidating PreQ1_1 transport kinetics and ECF transporter dynamics .

  • Biotechnological Engineering: Enhancing queuosine production in microbial cell factories .

  • Structural Biology: Crystallization trials to resolve transmembrane domain architecture .

Comparative Analysis of ECF Transporters

FeatureGroup I ECF TransportersGroup II ECF Transporters (QueT)
Energy ModuleDedicated ATP-binding cassette (ABC)Shared EcfAA′T module
Taxonomic RangeEnterobacteria, ActinobacteriaPredominantly Firmicutes
RegulationOperon-encodedRiboswitch-controlled (PreQ1_1)

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade activity; glycerol stabilization is critical .

  • Functional Validation: Further studies needed to confirm PreQ1_1 binding affinity in vitro.

  • Therapeutic Potential: Exploring queuosine’s role in tRNA modification and bacterial virulence .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary based on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us. We will prioritize developing the specified tag.
Synonyms
queT; llmg_1760; Queuosine precursor transporter QueT; Queuosine precursor ECF transporter S component QueT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Lactococcus lactis subsp. cremoris (strain MG1363)
Target Names
queT
Target Protein Sequence
MKKSKTYDIVTIAIVAALYVILTMTPGLSAISYGPIQFRVSEMLNFTAFFNKKYIIAVTI GCMISNFLSFTWVDVIVGGLSTLVFLSLGVLLFDRFKEDYFWNGQLNKAFFFFAIFFSIS MFTIALELKFVAETPFLLTWGTLALGEFASLFIGAFIMDKLGKRVDLSR
Uniprot No.

Target Background

Function
This protein is likely a queuosine precursor-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike traditional ABC transporters, this ECF transporter provides the energy needed for transporting various substrates. These substrates are bound by transmembrane proteins, not extracytoplasmic soluble proteins.
Database Links
Protein Families
Vitamin uptake transporter (VUT/ECF) (TC 2.A.88) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Queuosine precursor transporter QueT and what is its function in Lactococcus lactis?

The Queuosine precursor transporter QueT (queT) is a transmembrane protein found in Lactococcus lactis subsp. cremoris that functions as part of the energy-coupling factor (ECF) transport system. Specifically, it serves as the S-component responsible for the specific binding and transport of queuosine precursors across the bacterial cell membrane . In the context of bacterial metabolism, QueT plays a crucial role in the salvage pathway for queuosine (Q), a modified nucleoside found in tRNAs with GUN anticodons. This transport function allows L. lactis to uptake queuosine precursors from the environment rather than synthesizing them de novo, which can be metabolically advantageous in certain environments .

How does QueT differ from other queuosine-related transporters in bacteria?

QueT represents one of only two well-characterized transporter families that salvage queuosine precursors, the other being QPTR/COG1738 . The key differences between these transporters are summarized in the following table:

FeatureQueT (QrtT)QPTR/COG1738
FamilyEnergy-coupling factor (ECF) transporter, S-componentCOG1738 family
StructureSmall single protein with multiple transmembrane domainsMulti-component transporter
Energy sourceATP hydrolysis via associated T-componentProton or ion gradient
Substrate specificityPrimarily transports preQ₁Can transport multiple Q precursors including queuine
DistributionFound in diverse bacteriaMore restricted distribution

Recent research has identified additional transporter families that can transport queuosine precursors, including members of the ureide permease family (PF07168), hemolysin III family (PF03006), and Major Facilitator Superfamily (PF07690) . This diversity highlights the evolutionary plasticity of transporter functions and suggests that queuosine precursor transport capabilities may have evolved multiple times independently across different bacterial lineages.

What are the optimal expression systems for producing recombinant Lactococcus lactis QueT protein?

The optimal expression system for producing recombinant L. lactis QueT protein utilizes E. coli as the host organism, as evidenced by successful commercial preparations . The recommended methodological approach includes:

  • Vector selection:

    • pET series vectors containing T7 promoter systems

    • N-terminal His-tag fusion for purification purposes

    • Codon optimization for E. coli expression if necessary

  • Expression conditions:

    • BL21(DE3) or C41/C43(DE3) E. coli strains specifically designed for membrane protein expression

    • Culture in LB or TB media supplemented with 0.5% glucose

    • Growth at 37°C until OD₆₀₀ reaches 0.6-0.8

    • Induction with 0.5-1.0 mM IPTG

    • Post-induction cultivation at 16-18°C for 16-20 hours to enhance proper folding

  • Cell harvest and lysis:

    • Centrifugation at 5,000-6,000 × g for 15 minutes at 4°C

    • Resuspension in lysis buffer containing protease inhibitors

    • Membrane protein extraction using appropriate detergents (e.g., n-dodecyl-β-D-maltoside)

This expression system has been demonstrated to yield functional recombinant QueT protein suitable for further characterization and experimental applications .

What purification methods yield the highest purity for recombinant QueT protein?

Purification of recombinant His-tagged QueT protein to achieve greater than 90% purity requires a multi-step approach :

  • Initial capture using Immobilized Metal Affinity Chromatography (IMAC):

    • Solubilized membrane fraction is applied to Ni-NTA or TALON resin

    • Binding buffer typically contains 20-50 mM Tris-HCl pH 8.0, 300 mM NaCl, detergent above CMC, and 10-20 mM imidazole

    • Sequential washing with increasing imidazole concentrations (20-50 mM)

    • Elution with high imidazole buffer (250-500 mM)

  • Size Exclusion Chromatography (SEC):

    • Secondary purification step to remove aggregates and contaminants

    • Typical buffer: 20 mM Tris-HCl pH 7.5-8.0, 150 mM NaCl, detergent at 2× CMC

  • Optional ion exchange chromatography:

    • For removal of persistent contaminants if necessary

    • Buffer conditions optimized based on QueT theoretical pI

  • Final preparation:

    • Concentration using appropriate molecular weight cut-off centrifugal devices

    • Optional buffer exchange to remove excess detergent

    • Addition of stabilizers such as 6% trehalose for lyophilization

The purified protein should be assessed by SDS-PAGE to confirm >90% purity, with additional quality control through mass spectrometry or Western blotting using anti-His antibodies .

What are the critical considerations for maintaining QueT protein stability after purification?

Maintaining the stability of purified QueT protein requires careful attention to several factors:

  • Storage conditions:

    • Store lyophilized protein at -20°C/-80°C for long-term storage

    • Aliquot solutions to minimize freeze-thaw cycles

    • Working aliquots can be maintained at 4°C for up to one week

  • Buffer composition:

    • Tris/PBS-based buffer at pH 8.0 provides optimal stability

    • Inclusion of 6% trehalose protects protein structure during lyophilization

    • Addition of glycerol (final concentration 5-50%) helps prevent aggregation during freeze-thaw cycles

    • Maintain detergent concentration above CMC to prevent aggregation

  • Reconstitution protocol:

    • Briefly centrifuge vials before opening to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Allow complete dissolution before experimental use

    • For long-term storage of reconstituted protein, add glycerol to 50% final concentration

  • Experimental handling:

    • Minimize exposure to extreme temperatures or pH

    • Avoid repeated freeze-thaw cycles which can cause protein denaturation

    • Consider addition of reducing agents if the protein contains cysteine residues

These considerations are essential for maintaining the structural integrity and functional activity of recombinant QueT protein in research applications.

What experimental approaches can be used to assess the transport activity of recombinant QueT protein?

The transport activity of recombinant QueT protein can be assessed using several complementary experimental approaches:

  • Genetic complementation assays:

    • Generate E. coli strains with deletions in queuosine transporter genes

    • Transform with plasmids expressing recombinant QueT

    • Assess rescue of queuosine-related phenotypes through:
      a) Growth assays under specific selective conditions
      b) Analysis of tRNA modification status using APB-based affinity gels
      c) LC-MS/MS analysis of bulk tRNAs to quantify queuosine incorporation

  • In vitro transport assays:

    • Reconstitute purified QueT into proteoliposomes

    • Incubate with radiolabeled or fluorescently-labeled queuosine precursors

    • Measure time-dependent accumulation inside vesicles

    • Calculate kinetic parameters (Km, Vmax) for different substrates

  • Whole-cell uptake experiments:

    • Express QueT in cells lacking endogenous queuosine transporters

    • Incubate with labeled precursors (preQ₀, preQ₁, or queuine)

    • Analyze intracellular accumulation via:
      a) Scintillation counting for radiolabeled substrates
      b) HPLC or LC-MS/MS for direct quantification
      c) Fluorescence microscopy for fluorescent derivatives

  • Electrophysiological approaches:

    • Incorporate QueT into planar lipid bilayers

    • Measure currents associated with transport activity

    • Characterize the electrogenicity of the transport process

These methods provide complementary information about substrate specificity, transport kinetics, and mechanistic details of QueT-mediated transport.

How can researchers determine the substrate specificity of QueT protein?

Determining the substrate specificity of QueT protein requires systematic analysis using multiple methodological approaches:

  • Comparative genomic analysis:

    • Examine sequence conservation patterns in substrate-binding regions

    • Analyze QueT sequences from diverse bacteria and correlate with metabolic capabilities

    • Identify co-occurrence patterns with other queuosine pathway enzymes

  • Direct binding assays:

    • Isothermal titration calorimetry (ITC) with purified protein and potential substrates

    • Surface plasmon resonance (SPR) to measure binding kinetics and affinity

    • Microscale thermophoresis (MST) for rapid screening of multiple compounds

  • Functional transport assays:

    • Complementation tests in E. coli mutants with various queuosine precursors

    • Competition assays with labeled and unlabeled substrates

    • Concentration-dependent uptake measurements to determine Km values

  • Structural biology approaches:

    • Homology modeling based on related ECF transporters

    • Identification of substrate-binding pocket residues

    • Site-directed mutagenesis of key residues followed by functional testing

Current evidence suggests that QueT primarily transports preQ₀ and preQ₁, as demonstrated by complementation studies in heterologous systems . The specificity appears to be narrower than that of the alternative QPTR transporter, which can transport multiple queuosine precursors including queuine .

How does QueT integrate into the broader queuosine biosynthetic and salvage pathways?

QueT plays a pivotal role in the queuosine biosynthetic and salvage network, functioning as a critical link between extracellular precursor availability and intracellular utilization:

  • Pathway integration:

    • QueT facilitates the import of preQ₀ and preQ₁ precursors from the extracellular environment

    • These imported precursors can either:
      a) Enter the salvage pathway directly (preQ₁)
      b) Require further processing by enzymes like QueF (preQ₀)

    • The transported precursors ultimately serve as substrates for tRNA-guanine transglycosylase (TGT), which incorporates them into tRNA

  • Genomic context evidence:

    • QueT genes are frequently clustered with other queuosine metabolism genes

    • Common gene neighborhood patterns include co-localization with:
      a) TGT (catalyzes insertion of preQ₁ into tRNA)
      b) QueF (reduces preQ₀ to preQ₁)
      c) QueA (converts inserted preQ₁ to epoxyQ)

    • These clustering patterns support the functional integration of QueT in the pathway

  • Metabolic complementation:

    • In microbial communities, QueT may facilitate cross-feeding of queuosine precursors

    • Some organisms with incomplete queuosine biosynthetic pathways rely on QueT-mediated salvage

    • This creates metabolic interdependencies within structured microenvironments

  • Regulatory connections:

    • Expression of QueT may be coordinated with other queuosine pathway genes

    • Environmental factors that influence queuosine metabolism likely also affect QueT expression

    • Transport efficiency can serve as a rate-limiting step in queuosine incorporation

Understanding these integration points is essential for comprehending the full complexity of queuosine metabolism in bacteria and its importance in translational fidelity.

How can recombinant QueT protein be used to study queuosine metabolism in bacterial systems?

Recombinant QueT protein serves as a valuable tool for investigating queuosine metabolism in bacterial systems through multiple research applications:

  • Heterologous expression studies:

    • Express L. lactis QueT in different bacterial hosts lacking endogenous queuosine transporters

    • Assess cross-species functionality in queuosine transport

    • Evaluate the impact on tRNA modification profiles using LC-MS/MS analysis

  • Structure-function relationship investigations:

    • Generate site-directed mutants of key residues in QueT

    • Characterize the effects on transport activity and substrate specificity

    • Develop comprehensive models of the transport mechanism

  • Synthetic biology applications:

    • Engineer bacterial strains with controlled queuosine metabolism

    • Create reporter systems linking queuosine modification to detectable outputs

    • Develop biosensors for queuosine precursors based on QueT

  • Comparative analyses across bacterial species:

    • Express QueT homologs from different bacteria in standardized systems

    • Compare transport efficiencies, substrate preferences, and regulatory properties

    • Correlate functional differences with ecological niches and evolutionary relationships

  • Queuosine pathway reconstitution:

    • Combine purified components (QueT, TGT, QueA, QueG) in vitro

    • Establish minimal systems for queuosine incorporation into tRNA

    • Identify rate-limiting steps and regulatory points in the pathway

These applications provide insights into fundamental aspects of bacterial tRNA modification metabolism and may lead to novel biotechnological applications.

What is the significance of QueT in understanding bacterial tRNA modification systems?

The study of QueT protein contributes significantly to our understanding of bacterial tRNA modification systems in several key ways:

  • Transporter diversity and evolution:

    • QueT represents one of several convergently evolved solutions for queuosine precursor transport

    • Comparative analysis reveals remarkable transporter plasticity across bacterial lineages

    • At least five distinct protein families have evolved the ability to transport Q precursors, highlighting functional convergence

  • Metabolic network architecture:

    • QueT function illustrates how bacteria can balance de novo synthesis with salvage pathways

    • The presence of QueT allows metabolic flexibility and potential resource sharing in microbial communities

    • Reveals how tRNA modification systems are integrated with broader cellular metabolism

  • Queuosine metabolism biogeography:

    • Distribution patterns of QueT versus alternative transporters reflect ecological adaptations

    • Differences in transporter complement between free-living, commensal, and pathogenic bacteria suggest niche-specific requirements

    • Patterns in human microbiome bacteria indicate potential metabolic interactions within host environments

  • Translation quality control:

    • QueT-mediated transport directly impacts queuosine modification levels

    • Changes in modification status affect translational fidelity and efficiency

    • Links environmental conditions to translation quality through precursor availability

  • Evolutionary transitions in intracellular pathogens:

    • Changes in queuosine metabolism (from de novo synthesis to salvage) correlate with lifestyle adaptations

    • Transporters like QueT enable metabolic downsizing while maintaining essential functions

    • Represents a model for understanding genomic streamlining in host-adapted bacteria

These insights highlight the significance of QueT beyond its immediate role in queuosine transport, placing it in the broader context of bacterial adaptation and evolution.

How does the function of QueT compare in Lactococcus lactis versus other bacterial species?

The function of QueT exhibits both conservation and diversity across bacterial species, reflecting evolutionary adaptations to different ecological niches:

Bacterial SpeciesQueT CharacteristicsSubstrate SpecificityGenomic ContextPhysiological Role
Lactococcus lactis169 aa transmembrane proteinPrimarily preQ₁Often clustered with Q metabolism genesEssential for Q incorporation when de novo synthesis is absent
Escherichia coliSimilar structurepreQ₀ and preQ₁Part of complex Q metabolic networkComplements de novo synthesis
Bartonella henselaeAbsent (uses different transporters)N/AContains QPTR insteadMay represent evolutionary transition in Q metabolism
Acidobacteriota speciesUses alternative transporter (ureide permease)preQ₀ and preQ₁Novel genomic associationsDemonstrates transporter plasticity
Bifidobacterium speciesUses alternative transporter (hemolysin III family)preQ₀ and preQ₁Novel genomic associationsPotential probiotic relevance

Key comparative insights:

  • Substrate specificity: While most QueT homologs primarily transport preQ₁, the exact substrate preference and affinity may vary between species, likely reflecting differences in ecological niches and queuosine precursor availability.

  • Genomic organization: The genomic context of QueT genes shows species-specific patterns, with variable clustering with other queuosine metabolism genes, suggesting different evolutionary histories and regulatory strategies.

  • Functional redundancy: Some bacteria possess multiple transporters capable of queuosine precursor uptake, providing functional redundancy and metabolic flexibility.

  • Evolutionary patterns: The presence of QueT versus alternative transporters across bacterial lineages reveals complex evolutionary dynamics involving horizontal gene transfer, functional convergence, and adaptation to specific ecological niches .

  • Physiological context: In probiotic bacteria like certain Lactococcus lactis strains, QueT may contribute to general stress resistance and health-promoting properties, though direct evidence linking queuosine metabolism to probiotic effects requires further investigation .

These comparisons highlight the adaptive nature of queuosine metabolism across the bacterial domain and the central role of specialized transporters like QueT in this process.

What are the major technical challenges in working with recombinant QueT protein and how can they be addressed?

Working with recombinant QueT protein presents several technical challenges that require specialized approaches:

  • Membrane protein expression issues:

    • Challenge: Low expression yields and inclusion body formation

    • Solution: Use specialized E. coli strains (C41/C43), lower induction temperature (16-18°C), and optimize codon usage

    • Validation: Monitor expression using Western blotting with anti-His antibodies before proceeding to large-scale purification

  • Protein solubilization and stability:

    • Challenge: Maintaining native conformation during extraction from membranes

    • Solution: Screen multiple detergents (DDM, LMNG, digitonin) at concentrations above CMC

    • Validation: Assess protein homogeneity by size exclusion chromatography profiles and negative-stain electron microscopy

  • Functional reconstitution:

    • Challenge: Achieving proper orientation and functionality in artificial membranes

    • Solution: Optimize proteoliposome preparation using E. coli polar lipids or synthetic lipid mixtures

    • Validation: Confirm transport activity using radiolabeled substrates and compare with native membrane activity

  • Substrate availability:

    • Challenge: Limited commercial availability of queuosine precursors

    • Solution: Establish collaborations with synthetic chemistry laboratories or develop in-house synthesis protocols

    • Validation: Verify substrate purity using HPLC, NMR, and mass spectrometry before functional assays

  • Assay development:

    • Challenge: Establishing robust functional assays for transport activity

    • Solution: Develop complementary assays (genetic complementation, in vitro transport, binding studies)

    • Validation: Include appropriate positive and negative controls in all assays and ensure reproducibility

Addressing these challenges requires interdisciplinary approaches combining expertise in molecular biology, membrane biochemistry, and analytical techniques. The solutions provided offer a systematic strategy for overcoming the inherent difficulties in working with membrane transporters like QueT.

How can researchers investigate potential relationships between QueT function and bacterial physiology?

Investigating the relationship between QueT function and broader aspects of bacterial physiology requires multi-dimensional research approaches:

These approaches would provide comprehensive insights into how QueT-mediated queuosine precursor transport integrates with broader aspects of bacterial physiology, potentially revealing unexpected connections to stress responses, virulence, or probiotic properties.

What emerging research directions are expanding our understanding of QueT and queuosine metabolism?

Current research on QueT and queuosine metabolism is advancing in several innovative directions:

  • Microbiome-wide analysis of queuosine metabolism:

    • Metagenomic surveys of human microbiome reveal diverse queuosine salvage strategies

    • Evidence for queuosine precursor exchange within microbial communities

    • Previously unrecognized transporter families identified through genomic context analysis

    • Impact of diet and host factors on queuosine availability in the microbiome

  • Transporter plasticity and convergent evolution:

    • Recent discovery of multiple protein families capable of queuosine precursor transport

    • Experimental validation of transporters from the ureide permease family, hemolysin III family, and Major Facilitator Superfamily

    • Understanding of how different structural scaffolds evolved similar transport functions

    • Insights into the molecular basis of substrate specificity across diverse transporters

  • Structural biology advances:

    • Cryo-EM structures of ECF transporters providing mechanistic insights

    • Computational models predicting conformational changes during transport cycle

    • Structure-guided engineering of transporters with altered specificity or efficiency

  • Translational regulation mechanisms:

    • Connections between queuosine modification and selective translation of specific mRNAs

    • Role in stress responses and adaptation to changing environments

    • Potential regulatory functions beyond simple improvement of decoding accuracy

  • Therapeutic and biotechnological applications:

    • Queuosine metabolism as a potential target for antimicrobial development

    • Engineering of bacterial strains with enhanced or controlled queuosine metabolism

    • Application in probiotic development based on tRNA modification capabilities

These emerging research directions highlight the growing recognition of queuosine metabolism as an important aspect of bacterial physiology with implications for both fundamental biology and potential applications in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.