Recombinant Lactococcus lactis subsp. cremoris Riboflavin transporter RibU (ribU)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of RibU

RibU is a 206-amino acid transmembrane protein with five predicted membrane-spanning segments, though computational models initially suggested six . Structural analysis reveals it forms part of an evolutionarily conserved transporter family present in gram-positive bacteria and archaea . Key features include:

PropertyDetail
Gene locusribU (618 bp gene in L. lactis MG1363 genome)
Protein mass~23 kDa (calculated)
Expression systemRecombinant His-tagged version expressed in E. coli
Structural familyNovel transporter family, unclassified in Transport Classification Database

Functional Role in Riboflavin Transport

RibU facilitates high-affinity riboflavin uptake with a dissociation constant (KdK_d) of 0.6 nM . Key functional insights:

  • Substrate specificity: Binds riboflavin, flavin mononucleotide (FMN), and roseoflavin (toxic analog) but not flavin adenine dinucleotide (FAD) .

  • Mechanism: Likely operates via facilitated diffusion, driven by intracellular riboflavin conversion to FMN/FAD .

  • Genetic evidence:

    • Deletion mutants (ribUΔ) fail to consume extracellular riboflavin .

    • Radiolabeled riboflavin uptake is abolished in ribUΔ strains .

Transcriptional Regulation

RibU expression is controlled by an RFN (riboflavin) regulatory element upstream of the ribU gene :

  • Downregulation: Riboflavin and FMN suppress ribU transcription via the RFN element .

  • Operon linkage: Transcription is monocistronic, with a 0.95 kb transcript terminating at a rho-independent terminator .

  • Mutant behavior: Riboflavin-overproducing strain CB010 shows negligible ribU transcription regardless of extracellular riboflavin .

Biochemical and Biophysical Properties

Purified recombinant RibU exhibits unique spectral and binding characteristics :

  • Flavin binding:

    • Riboflavin fluorescence is quenched upon binding, suggesting stacking with tryptophan residues (e.g., Trp-68) .

    • Absorption peaks shift to 441, 464, and 486 nm in the bound state .

  • Detergent compatibility: Successfully solubilized and purified using nonionic detergents .

Research Applications and Implications

Recombinant RibU serves as a model system for:

  • Flavin transporter studies: Mechanistic insights into substrate recognition and energy coupling .

  • Biotechnological engineering: Overexpression in L. lactis could enhance riboflavin production for food fortification .

  • Pathogen research: Homologs in pathogens like Listeria monocytogenes are essential for intracellular survival, highlighting therapeutic targets .

Comparative Analysis of Wild-Type vs. Mutant Strains

ParameterWild-Type (NZ9000)ΔribU Mutant
Riboflavin uptakeActive (K<sub>d</sub> = 0.6 nM) Absent
Transcriptional controlRFN-dependent repression Deregulated in riboflavin-rich conditions
Growth in riboflavin-free mediumRequires 5 µM riboflavin Auxotrophic unless complemented

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
ribU; LLNZ_06150; Riboflavin transporter RibU; Riboflavin ECF transporter S component RibU
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Lactococcus lactis subsp. cremoris (strain NZ9000)
Target Names
ribU
Target Protein Sequence
MSKTRRMVLIAMLAALSTILLLPILQFPLLPGIDFMKVELSIIPVLIGVFTLGLGDGFII LFIRSVLWYLLFNQGPSTWIGVPMNFVALGIFMAIVWFFTKKKFSIKNYTVGIVLATIAS VLVMMVLNVFYALPLYRLAAGFDVDKIFAGATHLFNMGSLSVTLNPTYLLTVVLPFNALQ YIIFALVFGLIVTVFKKNKVVKFYNA
Uniprot No.

Target Background

Function
RibU is likely a riboflavin-binding protein interacting with the energy-coupling factor (ECF) ABC transporter complex. Unlike traditional ABC transporters, this ECF transporter provides energy for transporting various substrates. These substrates bind to transmembrane proteins, not extracytoplasmic soluble proteins. RibU mediates riboflavin uptake and likely transports FMN and roseoflavin as well.
Database Links
Protein Families
Prokaryotic riboflavin transporter (P-RFT) (TC 2.A.87) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the riboflavin transporter RibU in Lactococcus lactis?

RibU is a membrane transport protein in Lactococcus lactis subsp. cremoris that is responsible for the uptake of riboflavin (vitamin B2) from the extracellular environment. According to studies, RibU is predicted to contain five membrane-spanning segments and belongs to a novel transport protein family not described in the Transport Classification Database. Research has demonstrated that RibU is directly involved in riboflavin uptake, as strains with mutated ribU genes are unable to take up radiolabeled riboflavin from their growth medium .

The significance of RibU extends beyond simple nutrient acquisition. Its identification expanded our understanding of bacterial membrane transport systems by introducing a previously uncharacterized transporter family. Unlike many well-characterized bacterial transporters such as ABC transporters or those belonging to the Major Facilitator Superfamily, RibU represents a novel structural and functional paradigm for nutrient uptake in bacteria. This discovery has implications for understanding not only riboflavin metabolism but also for identifying similar transport systems in other microorganisms.

How is ribU gene expression regulated in Lactococcus lactis?

Transcriptional analysis has revealed that ribU transcription is downregulated in response to riboflavin and flavin mononucleotide (FMN). This regulation is presumably mediated by the structurally conserved RFN (riboflavin) element located between the transcription start site and the start codon. When a strain carries a mutated ribU gene, it exhibits altered transcriptional control of the riboflavin biosynthesis operon ribGBAH in response to riboflavin and FMN .

The RFN element functions as a riboswitch, sensing intracellular concentrations of FMN and modulating gene expression accordingly. This regulatory mechanism allows L. lactis to balance riboflavin uptake with de novo biosynthesis, optimizing resource allocation. The experimental evidence clearly demonstrates the regulatory interplay between transport and biosynthesis pathways, as mutations in ribU affect not only uptake capacity but also the responsiveness of the biosynthetic pathway to external riboflavin and FMN.

Table 1: Transcriptional responses in wild-type and ribU mutant strains

ConditionribU expression (WT)ribU expression (mutant)ribGBAH expression (WT)ribGBAH expression (mutant)
No riboflavinHighLow (mutated)HighHigh
+ RiboflavinLowLow (mutated)LowHigh
+ FMNLowLow (mutated)LowHigh

What substrates can the RibU transporter bind?

Research has shown that riboflavin, FMN, and the toxic riboflavin analogue roseoflavin can bind to RibU with high affinity. Specifically, these molecules bind to RibU with a 1:1 stoichiometry, with riboflavin having an extremely high affinity (Kd of 0.6 nM). Interestingly, FAD (flavin adenine dinucleotide) does not bind to the transporter. The binding of FMN and roseoflavin to RibU inhibits riboflavin uptake, suggesting they are also RibU substrates .

The substrate specificity pattern provides valuable insights into the structural constraints of the RibU binding pocket. The ability to bind riboflavin, FMN, and roseoflavin but not FAD suggests that the binding site can accommodate the isoalloxazine ring structure and ribityl chain but has steric limitations that prevent binding of the bulkier FAD molecule with its additional adenosine monophosphate moiety. This specificity profile allows researchers to make predictions about potential interactions with other flavin derivatives and design competitive inhibitors for experimental purposes.

Table 2: Substrate binding properties of RibU

CompoundBinding to RibUBinding Affinity (Kd)Inhibition of Riboflavin Uptake
RiboflavinYes0.6 nMN/A (primary substrate)
FMNYesNot specified in sourcesYes
RoseoflavinYesNot specified in sourcesYes
FADNoN/AN/A

What structural characteristics define the riboflavin binding pocket in RibU?

Spectroscopic analysis of purified RibU has revealed significant insights into its binding pocket structure. When riboflavin binds to RibU, its absorption spectrum changes dramatically, with well-resolved bands appearing at 441, 464, and 486 nm. These spectral changes indicate a hydrophobic binding pocket. Furthermore, the fluorescence of riboflavin is almost completely quenched upon binding to RibU, and the tryptophan fluorescence of the transporter is also quenched when flavins bind. These results suggest that riboflavin is stacked with one or more tryptophan residues in the binding pocket. Mutagenesis experiments have specifically identified Trp-68 as directly involved in riboflavin binding .

The spectroscopic properties of bound riboflavin provide a molecular fingerprint of the binding environment. The appearance of well-resolved vibrational bands in the absorption spectrum indicates a rigid binding environment that restricts the conformational mobility of riboflavin. The mutual quenching of riboflavin and tryptophan fluorescence is consistent with π-π stacking interactions between the planar isoalloxazine ring of riboflavin and the indole ring of Trp-68. These specific interactions likely contribute to the remarkably high binding affinity by providing precise geometric complementarity between the ligand and binding pocket.

Table 3: Spectroscopic changes upon riboflavin binding to RibU

Spectroscopic PropertyFree RiboflavinRiboflavin Bound to RibUInterpretation
Absorption peaksBroad bandsWell-resolved bands at 441, 464, 486 nmHydrophobic environment
Riboflavin fluorescenceHighAlmost completely quenchedStacking with aromatic residues
Tryptophan fluorescenceHighQuenched when flavins boundClose proximity of Trp to flavin

How does the transport mechanism of RibU differ from other membrane transporters?

The transport data collected from studies on RibU are consistent with a uniport mechanism for riboflavin translocation. This means that RibU facilitates the movement of riboflavin across the membrane without the coupled transport of another molecule or ion. This mechanism is notable because it provides the first detailed molecular and functional analysis of a bacterial protein involved in riboflavin transport. The exceptionally high affinity of RibU for its substrates (Kd for riboflavin is 0.6 nM) suggests a specialized transport mechanism that may differ from other nutrient transporters .

Table 4: Comparison of RibU with other transporter types

Transporter TypeEnergy SourceTypical Binding AffinityExampleRibU Similarity
ABC TransportersATP hydrolysisnM to μM rangeVitamin B12 transporter BtuCDHigh-affinity binding, but different energy mechanism
Secondary ActiveIon gradientsμM to mM rangeLactose permease LacYUniport mechanism, but much higher affinity
Facilitated DiffusionConcentration gradientμM to mM rangeGlucose transporter GLUT1Uniport mechanism, but much higher affinity
RibUConcentration gradient (presumed)0.6 nM-Unique combination of uniport mechanism with extremely high affinity

What is the relationship between RibU-mediated transport and riboflavin biosynthesis in Lactococcus lactis?

An interesting research finding is the relationship between RibU-mediated transport and the riboflavin biosynthesis pathway. In L. lactis, the riboflavin biosynthesis operon ribGBAH is transcriptionally regulated in response to riboflavin and FMN. When the ribU gene is mutated, this transcriptional control is altered. This suggests a sophisticated regulatory network where the cell can sense extracellular riboflavin levels through RibU and adjust its biosynthesis pathway accordingly. The fact that FMN can be transported by RibU is consistent with the observed transcriptional regulation of the ribGBAH operon by external FMN .

This regulatory interplay between transport and biosynthesis represents an elegant example of metabolic economy in bacteria. When riboflavin is available in the environment, L. lactis can downregulate its biosynthesis pathway, conserving energy and resources. The dual role of RibU in both transport and indirectly in regulation highlights the integrated nature of bacterial metabolic networks and provides an excellent model system for studying the coordination of nutrient acquisition and biosynthetic pathways.

Table 5: Integration of transport and biosynthesis pathways

Extracellular ConditionRibU ActivityribGBAH ExpressionCellular Strategy
High riboflavinActive transportDownregulatedConserve resources by using environmental riboflavin
Low riboflavinMinimal transportUpregulatedSynthesize riboflavin de novo
High FMNTransport of FMNDownregulatedUtilize environmental FMN
RibU mutationNo transportConstitutively high (unregulated)Forced to rely on biosynthesis regardless of environment

How can researchers overexpress and purify functional RibU for biochemical studies?

For biochemical and spectroscopic characterization of RibU, researchers have successfully overexpressed, solubilized, and purified the transporter. The purification process yields a bright yellow protein when cells are cultured in rich medium, indicating co-purification with riboflavin. To obtain substrate-free RibU for binding studies, expression in cells cultured in chemically defined medium is recommended. The purified transporter can then be used for various biochemical and spectroscopic analyses, including substrate binding assays and structural studies .

The expression and purification of membrane proteins like RibU present significant technical challenges due to their hydrophobic nature and tendency to aggregate. Successful strategies have involved optimizing the expression conditions, selecting appropriate detergents for solubilization, and developing efficient purification protocols. The ability to produce substrate-free RibU by controlling the growth medium composition is a valuable methodological advance that enables detailed binding studies without interference from pre-bound ligands.

Table 6: Protocol for RibU purification and substrate-free preparation

StepRich Medium (Substrate-Bound RibU)Chemically Defined Medium (Substrate-Free RibU)
Expression SystemL. lactis overexpressionL. lactis overexpression
Culture MediumRich medium (riboflavin-containing)Chemically defined medium (controlled riboflavin)
Visual ObservationBright yellow purified proteinColorless purified protein
SolubilizationDetergent extraction from membranesDetergent extraction from membranes
PurificationAffinity chromatographyAffinity chromatography
VerificationMass spectrometry to confirm riboflavin bindingMass spectrometry to confirm absence of riboflavin
ApplicationsStructural studies, spectroscopic analysisBinding assays, transport studies

What spectroscopic methods are effective for studying riboflavin binding to RibU?

Several spectroscopic methods have proven effective for studying riboflavin binding to RibU. Absorption spectroscopy reveals dramatic changes in the riboflavin spectrum upon binding, with well-resolved bands appearing at 441, 464, and 486 nm. Fluorescence spectroscopy demonstrates quenching of both riboflavin fluorescence and the tryptophan fluorescence of RibU upon binding, providing a sensitive method to monitor the interaction. Additionally, a detergent-compatible matrix-assisted laser desorption ionization time-of-flight (MALDI-TOF) mass spectrometry method has been used to identify riboflavin co-purified with RibU .

Each spectroscopic technique provides complementary information about the binding interaction. Absorption spectroscopy reveals changes in the electronic environment of riboflavin, fluorescence spectroscopy provides information about the spatial relationship between riboflavin and aromatic residues, and mass spectrometry confirms the identity and stoichiometry of bound ligands. Together, these methods provide a comprehensive picture of the molecular interactions in the binding pocket that can guide structural modeling and mutagenesis studies.

Table 7: Spectroscopic methods for studying riboflavin-RibU interactions

MethodInformation ProvidedTechnical ConsiderationsKey Findings for RibU
Absorption SpectroscopyElectronic environment, hydrophobicityRequires purified protein, potential detergent interferenceWell-resolved bands at 441, 464, 486 nm indicating hydrophobic environment
Fluorescence SpectroscopySpatial proximity, aromatic stackingHigh sensitivity, potential inner filter effectsQuenching of both riboflavin and tryptophan fluorescence, indicating stacking
MALDI-TOF Mass SpectrometryLigand identity, binding stoichiometryRequires specialized detergent-compatible methodsConfirmation of 1:1 riboflavin:RibU stoichiometry
Site-Directed Mutagenesis combined with spectroscopyIdentification of key binding residuesLabor-intensive, requires genetic systemTrp-68 identified as directly involved in riboflavin binding

How can researchers create and validate ribU mutants to study its function?

To create and validate ribU mutants, researchers have employed a range of genetic modification techniques in L. lactis. The validation of these mutants involves several complementary approaches. Transcriptional analysis can reveal changes in the expression levels of ribU and the riboflavin biosynthesis operon ribGBAH in response to riboflavin and FMN. Uptake assays using radiolabeled riboflavin can directly demonstrate transport deficiencies in the mutant strains. Growth studies can reveal whether the mutant strains consume riboflavin from their growth medium. Site-directed mutagenesis of specific residues like Trp-68 can identify key amino acids involved in substrate binding .

The creation of ribU mutants has been instrumental in elucidating both the transport function and the regulatory role of RibU. Complete gene knockouts help establish the essential role of RibU in riboflavin uptake, while site-directed mutagenesis of specific residues provides insights into the molecular mechanisms of substrate recognition and binding. The combination of genetic manipulation with functional assays offers a powerful approach to dissecting the structure-function relationships in this transporter.

Table 8: Methods for creating and validating ribU mutants

ApproachTechniqueExpected Outcome in MutantObserved Outcome in Research
Gene KnockoutHomologous recombinationNo riboflavin uptakeNo consumption of riboflavin from growth medium, no uptake of radiolabeled riboflavin
Site-Directed Mutagenesis (e.g., Trp-68)PCR-based mutagenesisReduced riboflavin bindingAltered spectroscopic properties, reduced binding affinity
Transcriptional AnalysisRT-PCR, reporter assaysAltered regulation of riboflavin biosynthesis genesConstitutive expression of ribGBAH regardless of riboflavin/FMN presence
Functional ComplementationWild-type gene reintroductionRestoration of riboflavin uptakeConfirmation that phenotype is specifically due to ribU mutation

How can researchers interpret changes in riboflavin absorption spectra upon binding to RibU?

When interpreting changes in riboflavin absorption spectra upon binding to RibU, researchers should focus on several key aspects. The appearance of well-resolved bands at 441, 464, and 486 nm indicates that riboflavin is in a hydrophobic environment, suggesting it is buried within a binding pocket in RibU. These spectral changes are consistent with riboflavin being in a less polar environment compared to aqueous solution, suggesting hydrophobic interactions within the binding pocket. The quenching of both riboflavin and tryptophan fluorescence suggests π-π stacking interactions between riboflavin and aromatic residues (particularly Trp-68) in the binding pocket .

The interpretation of spectroscopic data requires a solid understanding of the photophysical properties of riboflavin and how they are influenced by the local environment. The vibronic structure observed in the absorption spectrum provides information about the rigidity of the binding site and the restricted mobility of the bound riboflavin. Similarly, the fluorescence quenching phenomena offer insights into the electronic interactions between riboflavin and aromatic amino acids in the binding pocket. Researchers can compare these spectral signatures with those observed in soluble riboflavin-binding proteins of known structure to infer structural properties of the RibU binding site.

Table 9: Interpretation of spectroscopic changes in riboflavin upon binding to RibU

What does the high binding affinity of RibU for riboflavin (Kd = 0.6 nM) suggest about its physiological role?

The exceptionally high binding affinity of RibU for riboflavin (Kd = 0.6 nM) suggests several important aspects about its physiological role. RibU may be adapted to efficiently scavenge riboflavin from environments where this vitamin is present in extremely low concentrations. This high affinity may give L. lactis a competitive advantage in nutritionally challenging environments by enabling it to acquire riboflavin more efficiently than competing microorganisms. The high affinity binding may also be coupled to sensitive regulation of the riboflavin biosynthesis pathway, allowing the cell to respond to minimal changes in external riboflavin concentrations .

The nanomolar binding affinity of RibU for riboflavin places it among the highest-affinity transporters known in biology. This extreme binding affinity likely reflects evolutionary adaptation to environments where riboflavin is a limiting nutrient. For context, most bacterial transporters have affinities in the micromolar to millimolar range, making RibU's affinity approximately 1000-fold higher than typical transporters. This exceptional affinity raises interesting questions about the energetic and mechanical aspects of the transport cycle, particularly how such tightly bound riboflavin can be efficiently released on the cytoplasmic side of the membrane.

Table 10: Comparison of binding affinities across different transport systems

TransporterSubstrateBinding Affinity (Kd)OrganismReference
RibURiboflavin0.6 nMLactococcus lactisSearch result
BtuFVitamin B12~15 nMEscherichia coliLiterature comparison
ModAMolybdate~100 nMEscherichia coliLiterature comparison
MalEMaltose~1 μMEscherichia coliLiterature comparison
LacYLactose~1 mMEscherichia coliLiterature comparison

How do researchers reconcile the apparent contradiction between high-affinity binding and efficient transport in RibU?

One apparent contradiction in RibU function is how it combines extremely high-affinity binding (Kd = 0.6 nM) with efficient transport. This presents a mechanistic puzzle that researchers can approach by considering several possible mechanisms. The transporter likely undergoes significant conformational changes during the transport cycle that alter the binding affinity on different sides of the membrane. While the data are consistent with a uniport mechanism, the energy source driving the transport cycle and enabling the release of tightly bound riboflavin remains to be fully elucidated. Comparing RibU with structurally characterized transporters can provide insights into how conformational changes might facilitate the transport cycle despite high binding affinity .

Table 11: Possible mechanisms reconciling high-affinity binding with efficient transport

MechanismDescriptionEvidence in RibUResearch Implications
Alternating Access with Affinity SwitchingConformational changes alter binding affinity between inward-facing and outward-facing statesConsistent with uniport mechanismStructural studies to capture different conformational states
Local Environmental ChangespH or ion concentration differences between binding site and cytoplasm destabilize bindingNot directly investigated in available dataStudies of pH-dependence of binding and transport
Allosteric RegulationBinding of cytoplasmic factors alters binding affinityNot directly investigated in available dataIdentification of potential cytoplasmic interaction partners
Energy InputCoupling to ion gradients or other energy sources drives conformational changesConsistent with uniport mechanism, but energy source not identifiedInvestigation of ion dependency or other energy sources

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.