Recombinant Lactococcus lactis subsp. cremoris Thiamine precursor transporter HmpT (hmpT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
hmpT; llmg_0464; Thiamine precursor transporter HmpT; Thiamine precursor ECF transporter S component HmpT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Lactococcus lactis subsp. cremoris (strain MG1363)
Target Names
hmpT
Target Protein Sequence
MKLMDNKNIKKLTLLAIWTALTFVLGRLFTFPIPGSAGNILTLLDVGIYTAVFLFGKREA AIIGGFAAFLLDLTAGFSNYMFFSLIIHGGQGYLAGLTRYKWLNFLLSLLVMVGGYFIVG GLMYGWGSAIAGLWVNIVQVIVGFVLAKVLSPLIERTGILNGFRKA
Uniprot No.

Target Background

Function
HmpT is likely a thiamine precursor-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike typical ABC transporters, this ECF transporter provides the energy needed to transport a variety of substrates. These substrates are bound by transmembrane proteins, rather than extracytoplasmic soluble proteins.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is HmpT and what is its functional role in Lactococcus lactis?

HmpT (Thiamine precursor transporter) functions as an S-component of the ECF (Energy-Coupling Factor) transporter system in Lactococcus lactis subsp. cremoris. This integral membrane protein specifically facilitates the transport of thiamine precursors across the bacterial cell membrane, which is essential for thiamine (vitamin B1) biosynthesis and metabolism. HmpT is encoded by the hmpT gene (also designated as llmg_0464 in strain MG1363) . The protein consists of 166 amino acids and plays a critical role in nutrient acquisition, particularly in environments where thiamine availability is limited .

How is recombinant HmpT typically expressed and purified for research purposes?

Recombinant HmpT is typically expressed in E. coli expression systems using the full-length coding sequence (1-166 amino acids) fused to an N-terminal His-tag . The methodology involves the following steps:

  • Cloning: The hmpT gene sequence is optimized for expression in E. coli and cloned into an appropriate expression vector.

  • Expression: Transformed E. coli cells are cultivated under optimal conditions to induce protein expression. The specific conditions (temperature, induction time, medium composition) must be optimized for membrane protein expression.

  • Harvesting and Lysis: Cells are harvested by centrifugation and lysed using appropriate buffer systems that maintain membrane protein stability.

  • Purification: The His-tagged protein is purified using affinity chromatography methods, typically employing Ni-NTA or similar matrices. Due to HmpT being a membrane protein, detergents or other membrane-solubilizing agents are crucial during this process.

  • Quality Control: The purified protein undergoes quality assessment through SDS-PAGE analysis (>90% purity is considered acceptable for most research applications) .

The final product is often lyophilized for long-term storage and distributed with appropriate reconstitution protocols to maintain functional integrity.

What experimental approaches are most effective for studying HmpT functionality in vitro?

Studying HmpT functionality requires specialized approaches due to its nature as a membrane transporter. Effective methodologies include:

  • Reconstitution in Liposomes: Purified HmpT can be reconstituted into artificial liposomes to create a controlled system for transport assays. This approach involves:

    • Preparation of liposomes with defined lipid composition

    • Incorporation of purified HmpT into liposomes

    • Measuring transport activity using radiolabeled or fluorescently-labeled thiamine precursors

  • Substrate Binding Assays: To assess binding affinity without transport:

    • Isothermal titration calorimetry (ITC)

    • Surface plasmon resonance (SPR)

    • Microscale thermophoresis (MST)

  • Functional Complementation Studies: In vivo assessment of functionality:

    • Expression of recombinant HmpT in thiamine transport-deficient strains

    • Evaluation of growth restoration on thiamine-limited media

    • Quantification of intracellular thiamine using HPLC or LC-MS/MS

  • Site-Directed Mutagenesis: To identify critical residues:

    • Systematic mutation of conserved amino acids

    • Functional characterization of mutants

    • Correlation with structural predictions

These approaches should be combined with appropriate controls and validated against known transport kinetics parameters to ensure reliable results.

How does the expression and function of HmpT impact the fermentation characteristics of Lactococcus lactis?

The expression and function of HmpT can significantly influence the fermentation characteristics of Lactococcus lactis through its role in thiamine metabolism, which impacts several key metabolic pathways. Based on research on L. lactis fermentation characteristics, we can extrapolate the following relationships:

PropertyRange ObservedPotential HmpT Influence
Viscosity500-3500 mPa⋅sIndirect through EPS production pathways
WHC30-80%Indirect through protein metabolism
TA (°T)70-120Direct through pyruvate metabolism
pH decline rate0.1-0.3 units/hDirect through organic acid production

Researchers studying HmpT's impact on fermentation should employ comparative studies with HmpT-deficient mutants and wild-type strains to directly assess its contribution to these characteristics.

What are the challenges and solutions in maintaining stability of recombinant HmpT during experimental procedures?

Maintaining stability of recombinant HmpT presents several challenges due to its nature as a membrane protein. The following challenges and solutions should be considered:

  • Protein Aggregation and Misfolding:

    • Challenge: Membrane proteins like HmpT tend to aggregate when removed from their native lipid environment.

    • Solutions:

      • Use mild detergents (DDM, LMNG) at optimized concentrations

      • Add stabilizing agents such as glycerol (50%) to storage buffers

      • Consider nanodiscs or amphipols for maintaining native-like environment

  • Temperature Sensitivity:

    • Challenge: Repeated freeze-thaw cycles cause protein denaturation.

    • Solutions:

      • Store as aliquots to avoid repeated freeze-thaw cycles

      • For short-term use, store working aliquots at 4°C for up to one week

      • For long-term storage, maintain at -20°C/-80°C in buffer containing 50% glycerol

  • Buffer Composition:

    • Challenge: Inappropriate buffer conditions lead to loss of structural integrity.

    • Solutions:

      • Use Tris/PBS-based buffers with pH 8.0

      • Include 6% trehalose as a stabilizing agent

      • Optimize salt concentration based on protein behavior

  • Reconstitution Protocols:

    • Challenge: Inefficient reconstitution from lyophilized form.

    • Solutions:

      • Brief centrifugation prior to opening to bring contents to the bottom

      • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

      • Add glycerol to 5-50% final concentration for improved stability

Implementing these strategies will significantly enhance the stability and functionality of recombinant HmpT during experimental procedures, ensuring more reliable and reproducible research outcomes.

How can researchers apply HmpT in probiotic development and metabolic engineering applications?

Researchers can leverage HmpT in several innovative applications for probiotic development and metabolic engineering:

  • Enhanced Thiamine Production:

    • Overexpression of HmpT in probiotic strains can potentially increase thiamine uptake capability

    • This could create probiotic strains with improved vitamin B1 bioavailability

    • Engineered strains could address thiamine deficiencies through targeted supplementation

  • Metabolic Pathway Optimization:

    • HmpT can be incorporated into synthetic biology approaches to enhance flux through thiamine-dependent pathways

    • This may improve production of desirable metabolites and flavor compounds

    • Studies on L. lactis strains have identified connections between transporters and production of compounds like 3-methyl butanal and 3-methyl-2-butanone that contribute to malt aroma

  • Strain Selection and Improvement:

    • HmpT expression levels can serve as a biomarker for selecting strains with superior fermentation characteristics

    • Genetic modification of HmpT expression could enhance acidification rates and fermentation speed

    • This approach aligns with research showing significant technological diversity in fermentation characteristics among L. lactis isolates

  • Therapeutic Applications:

    • Similar to recombinant L. lactis delivering therapeutic molecules like P62 for inflammatory conditions , HmpT could be engineered as part of delivery systems

    • The transporter could potentially be modified to transport beneficial molecules beyond thiamine precursors

    • This builds on established approaches using recombinant probiotic bacteria to express and deliver bioactive molecules with anti-inflammatory properties

  • Bioproduction of Nutraceuticals:

    • Engineering HmpT specificity could create strains capable of producing or concentrating health-promoting compounds

    • This approach could utilize the natural GRAS (Generally Recognized As Safe) status of L. lactis

When designing such applications, researchers should consider performing extensive phenotyping similar to that described for L. lactis isolates, where parameters like fermentation time, viscosity, water holding capacity, and amino nitrogen production were systematically evaluated .

What analytical techniques are most effective for studying HmpT structure and function?

A comprehensive analysis of HmpT structure and function requires a multi-technique approach:

  • Structural Analysis Techniques:

    • Cryo-Electron Microscopy (Cryo-EM): Particularly valuable for membrane proteins like HmpT, providing high-resolution structural information without crystallization

    • X-ray Crystallography: Challenging for membrane proteins but provides atomic-level resolution if successful

    • Nuclear Magnetic Resonance (NMR): Useful for dynamic studies and investigating ligand interactions

    • Circular Dichroism (CD) Spectroscopy: For assessment of secondary structure composition and thermal stability

  • Functional Analysis Techniques:

    • Isotope-Labeled Substrate Transport Assays: To measure actual transport kinetics

    • Electrophysiology: For direct measurement of transport-associated currents

    • Fluorescence-Based Assays: Using fluorescent thiamine analogs to track binding and transport

  • Computational Approaches:

    • Molecular Dynamics Simulations: To model HmpT behavior in membranes and interaction with substrates

    • Homology Modeling: For predicting structure based on related transporters

    • Docking Studies: To identify potential binding sites and substrate interactions

  • Expression Analysis Methods:

    • Quantitative PCR: For measuring hmpT gene expression under different conditions

    • Western Blotting: For protein level quantification using anti-His antibodies

    • Flow Cytometry: When using fluorescently-tagged variants to assess membrane localization

Each technique provides complementary information, and integration of multiple approaches yields the most comprehensive understanding of HmpT structure-function relationships.

What are the recommended experimental designs for evaluating HmpT expression and function in different genetic backgrounds?

To robustly evaluate HmpT expression and function across different genetic backgrounds, researchers should implement the following experimental design considerations:

  • Expression System Selection:

    • E. coli Expression: Well-established for initial characterization and high-yield production

    • Native L. lactis Expression: For physiologically relevant studies

    • Alternative Hosts: Consider expression in B. subtilis or other Gram-positive bacteria for comparative studies

  • Vector Design Components:

    • Inducible promoters with tunable expression levels

    • Appropriate signal sequences for membrane targeting

    • Selection of affinity tags that minimally impact function (N-terminal His-tag has been validated)

    • Inclusion of TEV protease sites for tag removal if necessary

  • Genetic Background Variations to Consider:

    • Wild-type vs. hmpT deletion strains

    • Strains with different fermentation characteristics

    • Varying expression levels of ECF transporter components

  • Experimental Controls:

    • Empty vector controls

    • Expression of non-functional HmpT mutants

    • Complementation with native hmpT

  • Phenotypic Assessment Matrix:

ParameterMethodTimepointsReplicates
Growth rateOD600 measurementsEvery 30 min for 24hMinimum n=3
Thiamine uptakeHPLC/LC-MS/MS0, 2, 4, 8, 24hMinimum n=3
Gene expressionRT-qPCREarly, mid, late log phaseMinimum n=3
Protein localizationMembrane fractionationMid-log phaseMinimum n=2
Fermentation profilepH, TA measurementsEvery 4h during fermentationMinimum n=3
  • Statistical Analysis Approach:

    • ANOVA with appropriate post-hoc tests for comparing multiple strains

    • Time-series analysis for uptake and fermentation kinetics

    • Principal component analysis for multivariate data integration

This systematic approach ensures comprehensive evaluation of HmpT expression and function while controlling for genetic background variables that might influence experimental outcomes.

How can researchers troubleshoot common problems in HmpT expression and purification protocols?

When working with recombinant HmpT, researchers frequently encounter specific challenges. Here are systematic troubleshooting approaches for common issues:

  • Low Expression Yield:

    • Problem Signs: Weak or absent band on SDS-PAGE, low protein concentration after purification

    • Troubleshooting Approaches:

      • Optimize codon usage for the expression host

      • Test different expression temperatures (16°C, 25°C, 30°C)

      • Vary induction conditions (inducer concentration, induction timing)

      • Try auto-induction media formulations

      • Consider fusion partners known to enhance membrane protein expression

  • Protein Misfolding/Aggregation:

    • Problem Signs: Protein in inclusion bodies, aggregation during purification

    • Troubleshooting Approaches:

      • Reduce expression temperature to 16-20°C

      • Add membrane-mimicking agents during lysis (detergents, amphipols)

      • Include chemical chaperones in growth media (glycerol, DMSO at low concentrations)

      • Test different E. coli strains specialized for membrane protein expression

      • Consider mild solubilization conditions for inclusion bodies if necessary

  • Poor Purification Performance:

    • Problem Signs: Low binding to affinity resin, multiple contaminating bands

    • Troubleshooting Approaches:

      • Optimize imidazole concentration in binding/washing/elution buffers

      • Test different detergents for membrane solubilization

      • Consider tandem purification approaches (His-tag plus additional tag)

      • Implement size exclusion chromatography as a polishing step

      • Verify tag accessibility through Western blotting before purification

  • Loss of Stability During Storage:

    • Problem Signs: Precipitation after storage, loss of activity

    • Troubleshooting Approaches:

      • Always add glycerol (50%) to storage buffers

      • Aliquot to avoid freeze-thaw cycles

      • Verify pH stability of storage buffer

      • Add stabilizing agents like trehalose (6%)

      • Consider flash-freezing in liquid nitrogen before -80°C storage

  • Verification and Quality Control Tests:

    • SDS-PAGE with Coomassie staining (target: >90% purity)

    • Western blot using anti-His antibodies

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism to verify secondary structure integrity

    • Functional assays specific to thiamine precursor binding/transport

The optimization process should be systematic, changing one variable at a time and maintaining detailed records of conditions and outcomes to identify optimal expression and purification parameters.

What are the emerging areas of research involving HmpT in synthetic biology and metabolic engineering?

Several promising research directions are emerging for HmpT applications in synthetic biology and metabolic engineering:

  • Engineered Biosensors:

    • HmpT could be modified to create biosensors for thiamine and its precursors in environmental or biological samples

    • Such systems might couple transport activity to reporter gene expression

    • This approach could provide real-time monitoring of thiamine availability in fermentation systems

  • Substrate Specificity Engineering:

    • Directed evolution and rational design approaches could modify HmpT to transport alternative molecules

    • This could create novel transport capabilities for delivering therapeutic compounds or precursors

    • Similar approaches have been successful with other bacterial transporters

  • Metabolic Pathway Enhancement:

    • Integration of optimized HmpT variants into synthetic metabolic pathways

    • Potential to enhance thiamine-dependent pathway flux for improved production of valuable metabolites

    • This builds on established work with L. lactis in fermentation industries

  • Therapeutic Delivery Systems:

    • Building on research with recombinant L. lactis delivering therapeutic molecules

    • HmpT could be engineered as part of systems targeting specific tissues or cell types

    • Potential applications include targeted delivery to intestinal tissues similar to other L. lactis delivery systems

  • Structure-Function Studies:

    • Comparative analysis of HmpT with related ECF transporters

    • Determination of key residues involved in substrate specificity

    • Development of predictive models for transporter engineering

Each of these directions represents a significant opportunity for fundamental and applied research that could substantially advance our understanding and utilization of HmpT in biotechnological applications.

How might advances in structural biology techniques enhance our understanding of HmpT function?

Recent and emerging advances in structural biology techniques offer unprecedented opportunities to elucidate HmpT function at molecular and atomic levels:

These technological advances will likely reveal:

  • Precise substrate binding sites and mechanisms

  • Conformational changes associated with transport

  • Interactions with other ECF transporter components

  • Structural basis for substrate specificity

Such insights would significantly enhance rational engineering approaches for HmpT and related transporters in biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.