Recombinant Lactococcus lactis subsp. cremoris UPF0177 protein in abiGi 5'region

Shipped with Ice Packs
In Stock

Description

Protein Classification and Nomenclature

Recombinant Lactococcus lactis subsp. cremoris UPF0177 protein in abiGi 5'region belongs to the Uncharacterized Protein Family 0177 (UPF0177), indicating its structural classification has been established while its precise biological function remains incompletely characterized . The protein is also referred to by the alternative name "orfX" in some databases, reflecting its initial identification as an open reading frame of unknown function . The UniProt identification number assigned to this protein is Q48724, allowing for standardized reference in protein databases and research literature .

Recombinant Expression Systems

While the native protein originates from Lactococcus lactis subsp. cremoris, the recombinant version is produced using Escherichia coli as the expression host . This approach leverages E. coli's well-established expression systems for efficient protein production, despite Lactococcus lactis itself being recognized as an excellent host for membrane protein expression . The recombinant protein is engineered with an N-terminal histidine tag, which enables efficient purification through metal affinity chromatography without significantly altering the core protein structure .

Physical and Chemical Characteristics

The commercially available recombinant protein is supplied as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE analysis . While specific physical properties such as molecular weight and isoelectric point are not explicitly stated in the available research data, these can be estimated from the amino acid sequence. The high proportion of hydrophobic amino acids in the sequence suggests this protein requires specialized handling to maintain its native conformation and functionality.

Table 1: Key Properties of Recombinant Lactococcus lactis subsp. cremoris UPF0177 protein

PropertyDescription
Protein LengthFull Length (1-232 amino acids)
Source OrganismLactococcus lactis subsp. cremoris
Expression HostEscherichia coli
TagN-terminal Histidine tag
Physical FormLyophilized powder
PurityGreater than 90% (SDS-PAGE)
UniProt IDQ48724
Alternative NameorfX

Membrane-Associated Functions

Based on sequence analysis revealing multiple hydrophobic regions, the UPF0177 protein in abiGi 5'region likely functions as a membrane-associated protein . Its localization within the bacterial membrane suggests several potential functional roles:

  1. Membrane transport or channel activity

  2. Signal transduction across the membrane

  3. Structural contribution to membrane integrity

  4. Participation in protein complexes embedded in the membrane

The specific membrane-associated function has not been definitively established in the available research literature, representing a significant knowledge gap requiring further investigation.

Relation to Bacteriophage Resistance Mechanisms

The location of this protein in the abiGi 5'region provides intriguing hints about its potential biological role. The abiGi designation refers to abortive infection system Gi, a mechanism associated with bacteriophage resistance in Lactococcus lactis . Abortive infection systems function as bacterial defense strategies that induce cell death upon phage infection, thereby limiting phage propagation within bacterial populations.

The UPF0177 protein's position in this genetic region suggests possible involvement in bacteriophage resistance, potentially through:

  • Detection of phage components

  • Signal transduction in response to phage infection

  • Participation in programmed cell death pathways

  • Alteration of membrane properties to prevent phage entry or replication

Current Research Utilization

The commercial availability of recombinant UPF0177 protein facilitates various research applications in molecular biology and bacterial physiology studies . Current utilization primarily focuses on:

  1. Structural studies to determine three-dimensional conformation

  2. Functional assays to investigate biological activities

  3. Generation of antibodies for detection and localization

  4. Protein-protein interaction analyses

  5. Comparative studies with related proteins

The histidine-tagged recombinant version provides advantages for purification, detection, and immobilization in experimental settings, enhancing its utility as a research tool.

Potential Biotechnological Applications

While specific biotechnological applications of this particular protein are not detailed in available research data, proteins from Lactococcus lactis have found numerous applications in biotechnology and biomedical research. The established protocols for producing this protein in E. coli provide a foundation for potential scale-up if biotechnological applications are identified .

Potential applications could include:

  • Development of novel antimicrobial strategies based on bacteriophage resistance mechanisms

  • Biosensor development for detecting specific molecular targets

  • Protein engineering platforms for membrane protein studies

  • Applications in food technology, considering the importance of Lactococcus lactis in dairy fermentation

Challenges and Limitations

Working with membrane proteins like the UPF0177 protein presents several technical challenges that may limit research progress:

  1. Maintaining proper folding and functional conformation during expression and purification

  2. Ensuring stability during storage and experimental procedures

  3. Determining appropriate detergents or lipid environments for functional studies

  4. Limited understanding of the protein's natural biological context and function

These challenges necessitate careful experimental design and appropriate controls when utilizing this recombinant protein in research contexts.

Functional Characterization

Comprehensive functional characterization represents a critical research priority. Approaches might include:

  1. Targeted gene deletion or modification studies in Lactococcus lactis

  2. Heterologous expression in model systems with functional readouts

  3. Biochemical assays to test hypothesized activities

  4. Phage challenge experiments to investigate potential roles in resistance

These investigations would help transition this protein from its current "uncharacterized" status to one with defined biological functions.

Systems Biology Approaches

Integration of this protein into broader systems biology frameworks would provide contextual understanding of its role within Lactococcus lactis physiology. Approaches could include:

  1. Transcriptomic analysis under various growth conditions and stresses

  2. Proteomic studies to identify interaction partners

  3. Metabolomic investigations to identify affected pathways

  4. Comparative genomics across Lactococcus strains and related organisms

These approaches would help position the UPF0177 protein within relevant biological networks and processes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
UPF0177 protein in abiGi 5'region; orfX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Lactococcus lactis subsp. cremoris (Streptococcus cremoris)
Target Protein Sequence
MIKNHWMKKLKYLSLFFLLFAIYWFPDVILAYPEVYLKSLVGYERQVVATWIFLGNMSIS LFLGILICYKLGYYKNTISIFKIKNLLFLLITTIILFVIYFFSYTYYNSHFITPGIAKTQ AAFSIQIVFPFVQFITIAICAPIFEEASFRTTIYSFFKNDKIAYIVSCVGFAWMHTGPNP ILIVYLPMSIVLTSIYHRRRVLGESILVHGVFNALLPIVIPLLQVITGLYYL
Uniprot No.

Target Background

Function
The function of this protein is currently unknown, but it has been established that it is not essential for phage resistance.
Protein Families
UPF0177 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0177 protein in abiGi 5'region and why is it significant for research?

The UPF0177 protein is encoded in the 5' region of the abiGi gene in Lactococcus lactis subsp. cremoris (formerly known as Streptococcus cremoris). This protein has 232 amino acids with a specific sequence that includes transmembrane domains and potential functional regions . The protein's significance stems from its location within the abiGi region, which may be involved in bacterial defense mechanisms. Lactococcus lactis is one of the most important microorganisms in the dairy industry for cheese and buttermilk fermentation, making its defense proteins particularly relevant for both fundamental microbiology and industrial applications . Understanding proteins like UPF0177 contributes to our knowledge of how these bacteria function in various environments and how they might be engineered for biotechnological applications.

What are the optimal storage conditions for maintaining UPF0177 protein stability?

For maximum stability, the recombinant UPF0177 protein should be stored in Tris-based buffer with 50% glycerol at -20°C for routine storage or -80°C for extended storage periods . Laboratory best practices indicate that repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and loss of activity. For researchers conducting experiments over short time periods, working aliquots can be maintained at 4°C for up to one week . When designing experiments, it's important to consider that storage conditions can significantly affect protein structure and function, potentially introducing variables that may confound research outcomes. Storage buffer composition is specifically optimized for this protein to maintain its native conformation and biological activity.

What expression systems are recommended for producing recombinant UPF0177 protein?

Lactococcus lactis itself serves as an excellent expression host for this protein due to several advantageous characteristics. The L. lactis expression system offers rapid growth to high cell densities without requiring aeration, which facilitates large-scale fermentation with reduced costs and complexity . As a Gram-positive bacterium, L. lactis does not produce endotoxins that could contaminate the final protein product, making downstream purification simpler . Additionally, L. lactis secretes stable recombinant proteins into the growth medium with minimal protease activity, resulting in properly folded, full-length proteins that maintain their functional integrity . Various expression vectors are available for L. lactis, including those utilizing the pH-dependent P170 promoter, providing flexibility in experimental design and optimization strategies for different research objectives .

How does the primary structure of UPF0177 protein inform potential functions?

The amino acid sequence of UPF0177 protein (MIKNHWMKKLKYLSLFFLLFAIYWFPDVILAYPEVYLKSLVGYERQVVATWIFLGNMSISLFLGILICYKLGYYKNTISIFKIKNLLFLLITTIILFVIYFFSYTYYNSHFITPGIAKTQAAFSIQIVFPFVQFITIAICAPIFEEASFRTTIYSFFKNDKIAYIVSCVGFAWMHTGPNPILIVYLPMSIVLTSIYHRRRVLGESILVHGVFNALLPIVIPLLQVITGLYYL) reveals several structural features that provide clues about its potential functions . The sequence contains hydrophobic regions consistent with transmembrane domains, suggesting it may be a membrane-associated protein. Analysis of conserved motifs indicates potential involvement in transport or signaling pathways. While the specific function remains to be fully characterized, comparative sequence analysis with other bacterial proteins suggests possible roles in bacterial defense mechanisms, particularly given its location in the abiGi region which is associated with phage resistance systems in Lactococcus species.

What methodological approaches are most effective for purifying UPF0177 protein while maintaining its functional integrity?

Purification of UPF0177 protein requires a strategic approach that accounts for its structural characteristics and potential membrane association. After expression in L. lactis using appropriate vectors, initial purification can leverage the secretion of the protein into the growth medium, which significantly simplifies the first steps of purification . For researchers utilizing a tagged version of the protein, affinity chromatography represents an efficient first-step purification strategy. The tag selection should be determined during the production process to optimize for both expression and purification efficiency . Following initial capture, size exclusion chromatography can effectively separate the target protein from contaminants of different molecular weights. Throughout the purification process, it is crucial to maintain buffer conditions that stabilize the protein, possibly including glycerol or other stabilizing agents. Researchers should validate each purification step using SDS-PAGE and Western blotting to confirm identity and purity, followed by functional assays to ensure activity is preserved.

How can natural transformation approaches be applied to modify UPF0177 protein expression in L. lactis?

Natural DNA transformation represents a powerful approach for genetic modification of L. lactis strains expressing UPF0177 protein. Research has demonstrated that natural transformation is functional in L. lactis subsp. cremoris KW2, a plant-derived strain containing the complete set of proteins required for natural transformation . To activate this system, researchers can overexpress the master competence regulator ComX, which induces the expression of key competence genes necessary for DNA uptake . This methodology enables flexible genetic engineering approaches, including single point mutations, sequence insertions, or sequence replacements in the UPF0177 gene or its regulatory elements . The advantage of natural transformation over other genetic modification techniques is that it doesn't require specialized equipment for electroporation and avoids potential artifacts associated with artificial transformation methods. To optimize transformation efficiency, researchers should consider strain-specific factors and carefully design DNA constructs with homologous flanking regions to facilitate integration at the desired genomic locus.

What role might UPF0177 protein play in bacterial colonization and host interactions?

While the specific function of UPF0177 protein remains to be fully characterized, its structural features and genomic context provide insights into potential roles in bacterial colonization and host interactions. In other organisms, similar systems are involved in bacterial colonization, adhesion, and in some cases, pathogenesis . The protein may participate in secretion systems that mediate interactions between L. lactis and its environment. Interestingly, there have been rare reports of human infections caused by L. lactis subsp. cremoris, suggesting potential involvement in opportunistic pathogenicity under specific conditions . Research methodologies to investigate these functions could include knockout studies examining colonization efficiency, protein-protein interaction assays to identify binding partners, and comparative genomics across clinical and non-clinical isolates. Researchers should design experiments that examine UPF0177 function under various environmental conditions that mimic potential natural habitats of L. lactis, including plant surfaces, dairy environments, and mammalian mucosal surfaces.

How does the genetic context of the abiGi region influence UPF0177 protein expression and function?

The abiGi region in L. lactis represents an important genomic context that likely influences both the expression and function of the UPF0177 protein. Lactococcal strains harbor numerous plasmids containing functional modules separated by insertion sequence elements, which create distinct genetic architectures . The UPF0177 protein's location within the abiGi region suggests potential involvement in abortive infection (Abi) systems, which provide resistance against bacteriophages by triggering cell death upon infection, thereby preventing phage proliferation. Research approaches to investigate this relationship should include comparative genomic analyses across different L. lactis strains, transcriptomic studies examining co-expression patterns with other genes in the abiGi region, and functional assays assessing phage resistance. Methodologically, researchers could employ CRISPR-Cas9 or natural transformation techniques to create mutations in the genetic elements surrounding the UPF0177 gene to determine how disruption of this context affects protein function and phage sensitivity.

What considerations are essential when designing expression vectors for UPF0177 protein production?

When designing expression vectors for UPF0177 protein production, researchers must make several critical decisions to optimize yield and functionality. The selection of an appropriate promoter is paramount, with the pH-dependent P170 promoter having demonstrated success for recombinant protein expression in L. lactis . Signal peptide selection requires careful consideration - if secretion is desired, a compatible signal sequence that matches the characteristics of UPF0177 should be chosen. Tag selection represents another critical factor; while tags facilitate purification, they may interfere with protein folding or function . Therefore, researchers should consider whether N-terminal or C-terminal tags are more appropriate based on the protein's structure, and whether tag removal will be necessary for functional studies. Codon optimization for L. lactis may improve expression efficiency, particularly for heterologous proteins. Additionally, incorporation of appropriate transcription terminators and selection markers compatible with L. lactis is essential for stable maintenance of the expression vector. Researchers should conduct pilot experiments comparing different vector designs to identify the optimal configuration before scaling up production.

How can researchers effectively troubleshoot low expression levels of UPF0177 protein?

When confronting low expression levels of UPF0177 protein, researchers should implement a systematic troubleshooting approach. Begin by verifying vector sequence integrity through DNA sequencing to rule out mutations or frame shifts. Expression conditions should be optimized by testing different growth media compositions, temperatures, induction timing, and durations. For pH-regulated promoters like P170, precise pH control during cultivation is crucial . Protein solubility and stability challenges can be addressed by modifying buffer components, adding stabilizing agents like glycerol, or testing different growth temperatures that may improve protein folding . If intracellular degradation is suspected, co-expression with chaperones or use of protease-deficient host strains may improve yields. For secreted versions, signal peptide optimization or modifications to the secretion pathway genes might enhance extracellular accumulation. Quantitative PCR can determine if the issue occurs at the transcriptional level, while Western blotting can identify potential post-translational processing problems. Creating a panel of fusion constructs with different protein domains may help identify problematic regions affecting expression.

How should researchers approach comparative genomic analysis of UPF0177 homologs across different Lactococcus strains?

Comparative genomic analysis of UPF0177 homologs requires a multi-faceted bioinformatic approach. Researchers should begin by identifying homologs through BLAST searches against diverse Lactococcus genomes, applying appropriate E-value thresholds to balance sensitivity and specificity. Multiple sequence alignment tools such as MUSCLE or Clustal Omega can reveal conserved regions that may correspond to functional domains. Phylogenetic analysis using maximum likelihood or Bayesian methods should be employed to understand evolutionary relationships between homologs, revealing potential functional divergence. Analysis of selection pressure through dN/dS ratios can identify regions under purifying or positive selection, providing insights into functional constraints. Examination of the genomic context surrounding UPF0177 homologs is particularly important, as L. lactis strains have diverse plasmid contents with functional modules flanked by insertion sequence elements . Researchers should analyze whether UPF0177 consistently appears within the abiGi region and what other genes typically co-occur with it. Correlation of sequence variants with phenotypic data (e.g., phage resistance profiles) can generate hypotheses about structure-function relationships that can be tested experimentally.

How can researchers distinguish between direct and indirect effects when studying UPF0177 protein function?

Distinguishing direct from indirect effects in UPF0177 functional studies presents a significant challenge requiring specialized experimental approaches. Time-course experiments represent a fundamental strategy, as direct effects typically manifest more rapidly than downstream consequences. Dose-response relationships can provide valuable information, as direct effects often show clear concentration dependence. Researchers should employ in vitro reconstitution experiments with purified components to demonstrate direct interactions or activities without cellular complexity. For suspected protein-protein interactions, direct binding assays such as surface plasmon resonance or isothermal titration calorimetry provide quantitative binding parameters. Site-directed mutagenesis targeting specific functional residues can determine whether effects depend on particular protein features. If UPF0177 is hypothesized to have enzymatic activity, biochemical assays with purified protein can establish direct catalytic functions. Complementation experiments in which wild-type UPF0177 is expressed in knockout strains can confirm whether phenotypes are directly attributable to the protein. For transcriptional effects, chromatin immunoprecipitation followed by sequencing (ChIP-seq) or similar approaches can distinguish direct regulatory interactions from secondary effects. Researchers should integrate multiple lines of evidence rather than relying on single experimental approaches.

What genomic modification strategies show the most promise for studying UPF0177 protein function in vivo?

The field of bacterial genomic modification has advanced significantly, offering several promising approaches for investigating UPF0177 function in vivo. Natural transformation systems in L. lactis represent an elegant approach that has been successfully demonstrated in L. lactis subsp. cremoris KW2 . This method leverages the native competence machinery activated by overexpressing the master regulator ComX, allowing flexible modifications including point mutations, insertions, or sequence replacements . For precise genomic editing, CRISPR-Cas9 systems adapted for L. lactis offer advantages in efficiency and specificity. Researchers should consider developing inducible expression systems to study temporal aspects of UPF0177 function, which can be achieved using tetracycline-responsive or nisin-inducible promoters. For studying protein localization and dynamics, fluorescent protein fusions combined with super-resolution microscopy represent powerful approaches. To investigate protein-protein interactions in vivo, split-reporter systems such as FRET or BiFC (Bimolecular Fluorescence Complementation) offer spatiotemporal resolution not achievable with biochemical methods. For high-throughput functional analysis, transposon mutagenesis libraries combined with next-generation sequencing (Tn-seq) could identify genetic interactions with UPF0177.

How might recent advances in structural biology be applied to determine the three-dimensional structure of UPF0177 protein?

Determining the three-dimensional structure of UPF0177 protein would significantly advance understanding of its function and mechanism of action. Cryo-electron microscopy (cryo-EM) represents a particularly promising approach for membrane-associated proteins like UPF0177, as it doesn't require protein crystallization and can capture proteins in near-native environments. AlphaFold2 and similar AI-based structure prediction methods have revolutionized structural biology and could provide initial models to guide experimental work. For experimental structure determination, researchers should optimize expression and purification protocols to obtain sufficient quantities of properly folded protein . X-ray crystallography remains powerful but requires successful crystallization, which can be challenging for membrane proteins; specialized approaches such as lipidic cubic phase crystallization may improve success rates. NMR spectroscopy offers advantages for studying protein dynamics and can provide residue-specific information about protein-protein or protein-ligand interactions. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can complement these approaches by revealing regions of structural flexibility and conformational changes upon binding to partners. Integration of computational modeling with experimental data through techniques like molecular dynamics simulations can provide insights into functional mechanisms not directly observable through structural studies alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.