Recombinant Lactococcus lactis subsp. lactis ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

Lactococcus lactis subsp. lactis ATP synthase subunit b (atpF) is a component of the ATP synthase complex, an enzyme crucial for energy production in bacteria . ATP synthase, also known as F1Fo-ATPase, utilizes a proton gradient across the cell membrane to synthesize ATP, the primary energy currency of the cell . The atpF subunit is specifically a part of the Fo domain, which is embedded in the membrane and responsible for proton translocation .

Function and Importance

The ATP synthase complex is essential for the growth of Lactococcus lactis . The atpF subunit plays a critical role in the function of the Fo domain, facilitating proton flow that drives ATP synthesis . Disruption of ATP synthase activity can severely impair the ability of L. lactis to maintain a proton gradient, which is necessary for solute transport and maintaining cytoplasmic pH .

Recombinant Production and Applications

Recombinant atpF can be produced in E. coli using genetic engineering techniques, where the atpF gene is cloned and expressed, often with an N-terminal His tag for purification .

Homology Data of L. lactis atpF Subunit

The amino acid sequence of the L. lactis atpF subunit exhibits varying degrees of similarity to atpF subunits from other bacterial species. The following table summarizes the percentage identity and similarity of the L. lactis atpF subunit with corresponding subunits from other bacteria :

Source of ATPase% Identity (% similarity) of subunit b (atpF, 168 aa)
B. megaterium32 (62)
E. coli33 (55)
S. mutans46 (71)
Streptococcus faecalis41 (64)
S. bovis48 (72)
PS332 (59)
Synechococcus sp.28 (51)

Role in Acid Stress Response

L. lactis experiences acid stress in various environments, including during fermentation processes . ATP synthase activity, including the atpF subunit, is crucial for maintaining pH homeostasis under these conditions. The ability of L. lactis to regulate its internal pH is essential for its survival and metabolic activity in acidic environments .

Applications in Probiotic Research

Lactococcus lactis is a widely used probiotic bacterium, and its metabolic activities, including ATP synthesis, contribute to its health-promoting properties . Understanding the function and regulation of ATP synthase subunits like atpF can provide insights into optimizing the performance of probiotic strains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. To request a specific tag, please inform us; we will prioritize fulfilling such requests.
Synonyms
atpF; LL1768; L11208; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Target Names
atpF
Target Protein Sequence
MSTLLLEAAPNTVLGNIIVVSGAFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEAN NKQAADLVKQRQAELAGSKEEAANIIQVANDTASQNRAKVLATANEEATSLKKRAQEDIE QERKEALNTVKGDVADISVQIAEKLIGQSLDASAQQELIDSYLAKLGE
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, encompassing the membrane proton channel. These domains are linked via a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 to F0.

Database Links

KEGG: lla:L11208

STRING: 272623.L11208

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the functional role of ATP synthase subunit b (atpF) in Lactococcus lactis?

In Lactococcus lactis, which lacks a respiratory chain, the F1F0-ATPase functions by creating a proton gradient driven by ATP hydrolysis rather than synthesizing ATP. The atpF gene encodes subunit b, which is part of the membrane-intrinsic F0 component of this enzyme complex. This subunit plays a critical structural role in connecting the F1 and F0 domains while participating in proton translocation. The activity of the F1F0-ATPase in L. lactis increases as the pH of the growth media decreases, suggesting its importance in acid tolerance mechanisms . The ATP synthase complex is encoded by the atp operon (atpBEFHAGDC), with atpF positioned third in this gene cluster.

How is the atp operon organized in Lactococcus lactis?

The atp operon in Lactococcus lactis follows the gene arrangement atpBEFHAGDC. Northern blot analysis has revealed two primary transcripts: a full-length transcript of approximately 7.3 kb corresponding to the entire atp operon, and a shorter 4.5 kb transcript comprising the atpC, atpD, atpG, and atpA genes . The transcription initiation sites have been mapped using primer extension techniques, revealing no consensus promoter sequences. This suggests a complex transcriptional regulation mechanism for these genes. The complete operon encodes all eight subunits of the F1F0-ATPase complex, with the atpF gene (encoding subunit b) located in the third position of this gene arrangement.

How does the recombinant expression of atpF affect the transcriptome and proteome of Lactococcus lactis?

The overexpression of membrane proteins like atpF in L. lactis triggers significant cellular responses. Transcriptomic and proteomic analyses reveal upregulation of cell envelope stress response genes, particularly those in the CesSR regulon, which enhances the cell's capacity to remove misfolded proteins while promoting correct folding and insertion of proteins into the membrane . Unlike soluble protein overexpression, membrane protein overexpression (like atpF) typically causes downregulation of transcripts involved in nucleotide synthesis pathways (both purines and pyrimidines), which likely contributes to growth impairment .

The expression of membrane proteins also affects the regulation of metabolic pathways, with downregulation of glycolytic enzymes and pyruvate-dissipating enzymes, suggesting decreased metabolic energy requirements. Interestingly, genes involved in peptidoglycan layer biosynthesis show upregulation at both transcriptome and proteome levels, while fatty acid synthesis genes are downregulated . These complex cellular responses must be considered when designing expression systems for atpF.

What molecular mechanisms regulate atpF expression in response to environmental pH?

The absence of consensus promoter sequences at the transcription initiation sites suggests complex regulatory mechanisms potentially involving multiple transcription factors or alternative sigma factors. This regulation likely evolved as an adaptive response to acidic environments, allowing L. lactis to maintain intracellular pH homeostasis by increased proton extrusion through the F1F0-ATPase complex.

What structural modifications to atpF can enhance recombinant protein stability in Lactococcus lactis?

When expressing recombinant atpF in L. lactis, several structural modifications can enhance protein stability and functional expression. Codon optimization for the AT-biased genome of L. lactis (approximately 65%) is crucial for efficient translation . Strategic introduction of stabilizing mutations at the hydrophobic-hydrophilic interface regions of the transmembrane domains can improve membrane insertion efficiency without compromising function.

The addition of fusion tags requires careful consideration: N-terminal fusions may interfere with membrane insertion, while C-terminal fusions are generally better tolerated. When designing fusion constructs, researchers should incorporate flexible linker regions (typically containing glycine and serine residues) to minimize structural interference between domains. The selection of appropriate signal peptides, such as the Usp45 secretion signal used successfully for surface display of other proteins, can significantly improve correct localization .

What is the optimal protocol for cloning and expressing recombinant atpF in Lactococcus lactis?

The following protocol outlines an optimized approach for cloning and expressing recombinant atpF in L. lactis:

  • Gene preparation:

    • Amplify the atpF gene using primers incorporating appropriate restriction sites

    • For improved expression, consider codon optimization for L. lactis (AT-biased, ~65%)

  • Vector selection:

    • Choose a NICE system vector containing:

      • The nisin-inducible promoter (PnisA)

      • Appropriate selection markers (e.g., chloramphenicol resistance)

      • The Usp45 secretion signal if surface display is desired

  • Cloning strategy:

    • Due to lower cloning efficiency in L. lactis compared to E. coli, a two-step process is recommended:

      • Initial cloning in E. coli

      • Verification and subsequent transformation into L. lactis

  • Transformation protocol:

    • Prepare competent L. lactis cells using glycine treatment

    • Transform using electroporation at 2.5 kV, 25 μF, 200 Ω

    • Immediately recover in M17 medium supplemented with 0.5% glucose

  • Expression conditions:

    • Culture in M17 medium supplemented with 0.5% glucose at 30°C

    • Induce with 1-10 ng/ml nisin when OD600 reaches 0.4-0.6

    • Continue expression for 3-4 hours at 30°C

    • For membrane proteins like atpF, lower temperatures (18-25°C) during induction may improve folding

This protocol can be adapted based on specific experimental requirements and protein characteristics.

How can researchers verify the functional expression of recombinant atpF?

Verifying the functional expression of recombinant atpF requires a multi-faceted approach:

  • Membrane localization confirmation:

    • Fractionate cells to isolate membrane fractions

    • Perform western blot analysis using antibodies against atpF or incorporated tags

    • Use confocal microscopy with fluorescently labeled antibodies to visualize membrane localization

  • F1F0-ATPase complex assembly verification:

    • Blue native PAGE to analyze intact complex formation

    • Co-immunoprecipitation with antibodies against other F1F0-ATPase subunits

    • Cross-linking experiments followed by mass spectrometry analysis

  • Functional assays:

    • Measure ATPase activity using colorimetric phosphate release assays

    • Analyze proton pumping capability using pH-sensitive fluorescent dyes

    • Compare activity levels at various pH values (4.5-7.0) to assess pH-dependent regulation

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to evaluate secondary structure

    • Limited proteolysis followed by mass spectrometry to assess proper folding

    • Thermal shift assays to determine protein stability

This comprehensive verification approach ensures that the recombinant atpF is not only expressed but also correctly folded, assembled into the F1F0-ATPase complex, and functionally active.

What methods can be used to analyze the impact of atpF overexpression on Lactococcus lactis physiology?

Analyzing the impact of atpF overexpression on L. lactis physiology requires a systems biology approach:

  • Transcriptomic analysis:

    • RNA-Seq to identify differentially expressed genes

    • RT-qPCR for targeted verification of key stress response genes

    • Special focus on CesSR regulon genes involved in cell envelope stress

  • Proteomic analysis:

    • 2D gel electrophoresis combined with mass spectrometry

    • LC-MS/MS for quantitative proteomics

    • Phosphoproteomics to identify changes in signaling pathways

  • Metabolomic analysis:

    • Targeted analysis of glycolytic intermediates and ATP/ADP ratios

    • Measurement of organic acid production

    • Analysis of amino acid utilization patterns

  • Physiological measurements:

    • Growth rate and biomass yield determination

    • Acid tolerance assessment

    • Membrane integrity tests using fluorescent dyes

  • Electron microscopy:

    • TEM and SEM to observe morphological changes

    • ImmunoGold labeling to visualize atpF distribution in the membrane

These complementary approaches provide a comprehensive understanding of how atpF overexpression affects cellular physiology. Previous studies have shown that overexpression of membrane proteins in L. lactis leads to upregulation of cell envelope stress response genes and downregulation of nucleotide synthesis pathways .

How can researchers address poor expression levels of recombinant atpF?

Poor expression levels of recombinant atpF may be addressed through systematic optimization strategies:

  • Genetic optimization:

    • Codon optimization to match L. lactis codon usage bias (65% AT-biased)

    • Removal of rare codons and secondary structures in mRNA

    • Optimization of the translation initiation region

    • Testing of different signal peptides if secretion/surface display is intended

  • Expression system adjustments:

    • Fine-tuning of inducer (nisin) concentration (1-50 ng/ml range)

    • Optimization of induction timing (typically at OD600 0.4-0.6)

    • Temperature reduction during induction (18-25°C)

    • Media composition adjustments (carbon source, nitrogen source)

  • Host strain engineering:

    • Selection of L. lactis strains with enhanced membrane protein expression capacity

    • Consideration of proteases-deficient strains to reduce degradation

    • Co-expression of molecular chaperones to improve folding

  • Expression construct design:

    • Testing different fusion tags (His, FLAG, STREPII)

    • Incorporation of solubility-enhancing partners

    • Optimization of linker regions between fusion partners

When implementing these strategies, it's advisable to use a design of experiments (DOE) approach to systematically test multiple parameters simultaneously and identify optimal conditions.

What statistical approaches are best for analyzing atpF-related transcriptomic data?

When analyzing transcriptomic data related to atpF expression studies, researchers should consider the following statistical approaches:

  • Differential expression analysis:

    • DESeq2 or edgeR for RNA-Seq data analysis

    • LIMMA for microarray data

    • Multiple testing correction using Benjamini-Hochberg procedure

  • Co-expression network analysis:

    • WGCNA (Weighted Gene Co-expression Network Analysis) to identify gene modules

    • Pearson or Spearman correlation coefficients for pairwise gene correlations

    • Network visualization using Cytoscape

  • Pathway enrichment analysis:

    • Gene Set Enrichment Analysis (GSEA)

    • Over-representation analysis using Fisher's exact test

    • KEGG pathway or Gene Ontology term enrichment

  • Principal Component Analysis (PCA) and clustering:

    • PCA for dimension reduction and visualization of sample relationships

    • Hierarchical clustering with appropriate distance metrics

    • t-SNE or UMAP for non-linear dimensionality reduction

  • Time-series analysis (if applicable):

    • STEM (Short Time-series Expression Miner)

    • Autoregressive models for temporal expression patterns

    • Impulse models for transient expression changes

The choice of statistical method should be guided by experimental design, sample size, and specific research questions. Previous studies on membrane protein overexpression in L. lactis have shown significant regulation of stress response genes, particularly those in the CesSR regulon, which should be closely examined in the analysis .

How do researchers resolve contradictory findings in atpF functional studies?

Resolving contradictory findings in atpF functional studies requires a systematic and comprehensive approach:

  • Methodological variation assessment:

    • Compare experimental protocols in detail (expression systems, purification methods)

    • Evaluate protein tags and their potential interference with function

    • Consider differences in assay conditions (pH, temperature, buffer composition)

  • Protein structure-function relationship analysis:

    • Assess potential differences in protein conformation using structural biology techniques

    • Examine post-translational modifications that might affect function

    • Consider allosteric effects from experimental conditions

  • Strain-specific variation analysis:

    • Compare genome sequences of L. lactis strains used in different studies

    • Evaluate strain-specific regulatory networks that might affect atpF function

    • Consider genetic background effects on atpF expression and function

  • Integration of multiple data types:

    • Combine functional assays with structural studies

    • Correlate transcriptomic/proteomic data with functional outcomes

    • Develop mathematical models to explain divergent observations

  • Meta-analysis approaches:

    • Systematically review all studies with standardized inclusion criteria

    • Apply statistical methods to integrate results across studies

    • Identify moderator variables that explain contradictory findings

When communicating results, researchers should clearly describe all experimental conditions and discuss limitations openly. Collaborative efforts between groups with contradictory findings can be particularly valuable in resolving discrepancies through standardized experiments conducted across multiple laboratories.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.