Recombinant Lactococcus lactis subsp. lactis DNA translocase FtsK (ftsK)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ftsK; LL1656; L0211; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Target Names
ftsK
Target Protein Sequence
MSESKKMPAKKKTTRRNTKKEQQKKAATRKMIAFFVGLLLILFALARLGIVGVLLYNIVR
LFVGSLAIVFLLLLAGLMIISVFRKQVLKENKRIIPAIILTFIGLMFVFQIRLHQGFNET
FHLIWSDLMAGRVIHFVGSGVIGALITEPAKALFSVIGVYIIAAVLWLVAIYLMIPGLFP
KMREDLHQRLAKWKEKHAEKVEAKKAAKALAELEKKQAVAEREELPEAAENSLFTSAPTE
IPINIPEAPFEENETESPVLAEVPLDDEPVNFSNTNNYNGNYKLPTIDLLAEVPVKNQSG
ERENVRKNIGILEETFKSFGIGANVESAVVGPSITKYEIKLATGTKVSRVVNLSDDLALA
LAAKDIRIEAPIPGKSLVGVEIPNAEVAMVGFREMWEAGKTNPSKLLEIPLGKSLDGGIR
TFDLTRMPHLLVAGSTGSGKSVAVNGIITSILMKALPSQVKFLMVDPKMVELSVYNDIPH
LLIPVVTNPRKASRALQKVVDQMEERYELFSRYGVRNIAGYNEKVQRYNAESDEKMLELP
LIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVDVISGLIKANVPS
RIAFAVSSGTDSRTILDTNGAEKLLGRGDMLFKPIDENHPIRLQGAFLSDDDVESVVTFI
KDQSEAQYDESFDPGEVDESQVGTGASNTGSGDPLFEEARNMVIMAQKASTAQLQRALKV
GFNRASDLMNELEAQGIVGPAKGTTPRKVLVSPDGEFIGGVEE
Uniprot No.
Target Background
Function
FtsK is an essential cell division protein that plays a crucial role in coordinating cell division and chromosome segregation. Its N-terminus is involved in the assembly of the cell division machinery. The C-terminus acts as a DNA motor that moves dsDNA in an ATP-dependent manner towards the difSL recombination site, located within the replication terminus region. FtsK is required for the activation of the XerS recombinase, enabling chromosome unlinking by recombination.
Database Links
KEGG: lla:L0211
STRING: 272623.L0211
Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
