Recombinant Lactococcus lactis subsp. lactis Lactococcin transport/processing ATP-binding protein LcnC-like (lcnC)

Shipped with Ice Packs
In Stock

Description

Transport Mechanism

LcnC operates as part of a type I secretion system alongside accessory protein LcnD :

  1. ATP Hydrolysis: The ABC domain hydrolyzes ATP to energize translocation .

  2. Precursor Processing: Cleaves the leader peptide of lactococcin A precursors on the cytoplasmic side of the membrane .

  3. Membrane Topology:

    • Cytoplasmic N- and C-termini

    • Three transmembrane segments anchor the protein .

Substrate Specificity

  • Primarily transports lactococcin A, B, and M/N .

  • Homologous systems (e.g., PedC/PedD in pediocin secretion) share structural similarities .

Biotechnological Production

Recombinant Expression Protocols

  • Vector Design: Plasmid-driven expression in E. coli, yeast, or mammalian cells .

  • Purification: Affinity chromatography using His-tag, yielding ≥85–90% purity .

  • Storage: Lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) for stability .

Key Challenges:

  • Maintaining plasmid stability in L. lactis during large-scale fermentation .

  • Avoiding proteolytic degradation during extraction .

Antimicrobial Activity Enhancement

  • Recombinant LcnC expression boosts lactococcin A secretion by 2.5-fold in modified L. lactis strains .

  • Mechanism: Co-expression with LcnD increases transporter assembly efficiency .

Industrial Relevance

  • Dairy Fermentation: Enhances bacteriocin-mediated inhibition of spoilage bacteria (e.g., Pseudomonas spp.) .

  • Therapeutic Potential: Engineered L. lactis strains with LcnC could deliver anticancer peptides (e.g., KISS1) via secretion systems .

Comparative Analysis with Homologs

FeatureLcnC (L. lactis)PedC (Pediococcus)HlyB (E. coli)
ABC TransporterYesYesYes
Leader Peptide ProcessingCytoplasmicExtracellularN/A
SubstrateLactococcin APediocin PA-1Hemolysin A
Accessory ProteinLcnDPedDHlyD

Future Directions

  • CRISPR-Cas Engineering: Optimizing lcnC expression for high-yield bacteriocin production .

  • Clinical Trials: Testing recombinant LcnC-bearing strains for colorectal cancer suppression via peptide delivery .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery estimates, please contact your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lcnC; LL0079; L82520; Lactococcin transport/processing ATP-binding protein LcnC-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-715
Protein Length
full length protein
Species
Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Target Names
lcnC
Target Protein Sequence
MKFKKKNYTSQVDEMDCGCAALSMILKSYGTEKSLASLRLLAGTTIEGTSALGIKKAGEG LGFVVQVLRADASLFEMKKVPYPFIAHVIKNQKYPHYYVITGANKNSVFIADPDPTVKMT KLSKEVFLSEWTGISLFLSPTPSYQPTKEKTSSLLSFIPIITRQKKVILNIVIASFIVTL INILGSYYLQSMIDSYIPNALMGTLGIISVGLLLTYIIQQVLEFAKAFLLNVLSQRLAID VILSYIRHIFQLPMSFFSTRRTGEITSRFSDASSILDAIASTILSLFLDLTIVLMTGLIL GLQNMQLFLLVLLAIPLYIVVIIIFTPLFERQNHEVMQTNAILNSSIIEDINGIETIKAL ASEQERYQKIDYEFASYLKEAFTLQQSEAIQTAIKTTVQLVLNVLILWFGATLVMHQKIT LGQLITFNALLSYFTNPITNIINLQTKLQKARVANERLNEVYLVPSEFEEKKTELSLSHF NLNMSEISYQYGFGRKVLSEIKLSIKENEKLTIVGISGSGKSTLVKLLVNFFQPTSGTIT LGGIDLQQFDKHQLRRLINYLPQQPYIFTGSIMDNLLLGASEATSQEEIIRAVELAEIRA DIEQMQLGYQTELSSDASSLSGGQKQRIALARALLSPAKILILDEATSNLDMITEKKILK NLLALDKTIIFIAHRLSVAEMSHRIIVIEQGKVIESGSHSELLAQNGFYAQLYHN
Uniprot No.

Target Background

Function
Involved in the export process of the bacteriocin lactococcin.
Database Links

KEGG: lla:L82520

STRING: 272623.L82520

Protein Families
ABC transporter superfamily, HlyB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of LcnC in bacteriocin transport in Lactococcus lactis?

LcnC functions as an essential component in the transport and maturation system for lactococcins, which are bacteriocins produced by Lactococcus lactis. LcnC is a member of the ABC transporter family and acts as a putative transmembrane protein with several transmembrane sequences (TMS). It works in conjunction with LcnD to enable the extracellular activity of bacteriocins. Without functional LcnC and LcnD proteins, bacteriocins cannot be effectively transported across the cell membrane, resulting in no extracellular bacteriocin activity .

What is the relationship between LcnC and LcnD in the bacteriocin transport system?

LcnC and LcnD function together as essential components for the extracellular activity of lactococcins. While LcnC is a member of the ABC transporter family with multiple transmembrane sequences, LcnD contains one transmembrane helix that spans the cytoplasmic membrane with its N-terminal part located intracellularly. These proteins are believed to form a functional complex that facilitates the transport and possibly the processing of bacteriocin precursors. The complementary topologies of these proteins suggest they may interact physically to create an effective transport pathway for bacteriocins across the cellular membrane .

How do bacteriocins like lactococcins function in Lactococcus lactis?

Lactococcins are small heat-stable, non-lanthionine-containing membrane-active peptides produced by Lactococcus lactis. They are characterized by a specific Gly-Gly₋₁-X₊₁ processing site (where X is any amino acid) in their precursor form. These bacteriocins typically target the cell membranes of competing bacteria, creating pores that disrupt membrane integrity and lead to cell death. The production and release of these bacteriocins give L. lactis a competitive advantage in its environment by inhibiting the growth of competing bacterial species .

What are the recommended approaches for studying LcnC expression in recombinant Lactococcus lactis systems?

For studying LcnC expression in recombinant L. lactis systems, researchers should consider the following methodological approach:

  • Vector Selection: Use pWV01 derivatives with strong lactococcal promoters such as P32 to achieve robust expression of the LcnC protein.

  • Expression System: Design constructs that can be tested in both E. coli and L. lactis to compare expression efficiency and protein functionality across different bacterial hosts.

  • Culture Conditions: For optimal expression, culture L. lactis in glucose-supplemented M17 broth (0.5% glucose) at 30°C without agitation. For recombinant strains carrying plasmids, supplement the medium with appropriate antibiotics (e.g., erythromycin at 125 μg/mL).

  • Protein Detection: Employ Western blotting with specific antibodies or use fusion tags (e.g., His-tag) for detection and purification of expressed LcnC.

  • Functional Assays: Assess bacteriocin transport efficiency through antimicrobial activity assays against sensitive indicator strains .

What standardized assay conditions should be used when measuring enzyme activities in Lactococcus lactis?

To achieve reproducible and physiologically relevant measurements of enzyme activities in L. lactis, researchers should implement the following standardized conditions:

  • Assay Medium Composition: Design an assay medium that mimics the intracellular environment of L. lactis based on elemental analysis of cells grown in chemostat cultures. The table below shows the recommended ion concentrations:

ElementIntracellular Concentration (mM)
K559-570
Mg53-59
Na37-60
S59-63
Ca0.42-0.76
Mn0.67-0.68
  • pH Conditions: Maintain assay pH at levels representative of the intracellular pH of L. lactis (approximately pH 7.0-7.5 for non-stressed cells).

  • Sample Handling: Certain enzymes show significant activity loss upon freezing. For accurate measurements, enzymes like GLK, TPI, and ADH should be measured on the same day as cell harvesting, while GAPDH, PGK, and ENO must be measured within 3 days.

  • Measurement Protocol: Optimize procedures for 96-well plate formats to increase throughput and reproducibility.

  • Validation: Always compare the maximal enzyme activities (Vmax) with measured in vivo fluxes to ensure that the enzymatic capacity can support the observed metabolic rates .

How can researchers effectively measure the transport activity of LcnC in laboratory settings?

To effectively measure LcnC transport activity:

  • Bacteriocin Activity Assays:

    • Create a lawn of bacteriocin-sensitive indicator strain on appropriate agar medium

    • Apply filtered supernatants from wild-type and recombinant LcnC-expressing strains

    • Measure and compare zones of inhibition after incubation

  • Transport Efficiency Measurement:

    • Quantify bacteriocin in intracellular and extracellular fractions using immunological methods

    • Calculate the ratio of extracellular to total bacteriocin as a measure of transport efficiency

  • Complementation Studies:

    • Use lcnC knockout strains complemented with various LcnC variants to assess functional domains

    • Measure restoration of bacteriocin transport to determine essential regions of the protein

  • ATP Consumption Assays:

    • Since LcnC is an ATP-binding protein, measure ATP hydrolysis rates in membrane preparations

    • Use methods like the luciferase-based ATP detection assay or radioactive ATP to quantify consumption

  • Protein Interaction Studies:

    • Employ pull-down assays or bacterial two-hybrid systems to confirm interactions between LcnC and LcnD

    • Use fluorescently tagged proteins to visualize co-localization at the membrane .

What are the functional domains of LcnC and how do mutations in these domains affect bacteriocin transport?

The LcnC protein contains several functional domains critical for its bacteriocin transport activity:

  • ATP-Binding Domain: Contains conserved Walker A and B motifs responsible for ATP binding and hydrolysis. Mutations in the conserved lysine residue of the Walker A motif typically abolish ATP binding capacity, rendering the transport system non-functional.

  • Transmembrane Domains: Several transmembrane segments that form a channel through which bacteriocins are transported. Alterations in the hydrophobic character or length of these segments can disrupt membrane insertion and channel formation.

  • Peptide-Binding Domain: Responsible for recognizing the leader sequence of bacteriocin precursors. Mutations in this region may affect substrate specificity and transport efficiency.

  • Interaction Domain: Region that mediates interaction with LcnD. Modifications in this area can disrupt the formation of the functional transport complex.

Systematic mutagenesis studies have shown that even conservative amino acid substitutions in the ATP-binding cassette can dramatically reduce transport efficiency, while modifications in the transmembrane regions may alter the range of bacteriocins that can be transported. Understanding these structure-function relationships is crucial for engineering recombinant L. lactis strains with enhanced or modified bacteriocin transport capabilities .

What are the differences in transport mechanisms between LcnC and other ABC transporters involved in bacteriocin export in different bacterial species?

LcnC belongs to the family of ABC transporters involved in bacteriocin export, but exhibits several distinct characteristics compared to other bacteriocin transporters:

  • Substrate Processing: Unlike some bacteriocin transporters that include an N-terminal protease domain for leader peptide cleavage, LcnC appears to function primarily in transport, working in conjunction with LcnD for effective bacteriocin secretion.

  • Structural Organization: While many bacteriocin transporters function as homodimers, the LcnC-LcnD system represents a heterodimeric arrangement with complementary membrane topologies. LcnD has a single transmembrane helix with its N-terminal part located intracellularly, whereas LcnC contains multiple transmembrane segments.

  • Substrate Specificity: LcnC demonstrates specificity for non-lanthionine containing bacteriocins characterized by the Gly-Gly₋₁-X₊₁ processing site, distinguishing it from lantibiotic transporters that handle more structurally complex peptides.

  • Energy Coupling: While all ABC transporters use ATP hydrolysis to drive transport, the stoichiometry and efficiency of ATP utilization may differ between LcnC and other bacteriocin transporters.

Comparative studies examining the substrate range, transport kinetics, and energy requirements of various bacteriocin transporters would provide valuable insights into the specialized adaptations that have evolved in different bacterial species for bacteriocin export .

What are the optimal cloning strategies for expressing functional LcnC in Lactococcus lactis?

For optimal expression of functional LcnC in L. lactis, researchers should consider the following cloning strategies:

  • Promoter Selection: Use the strong constitutive P32 promoter for high-level expression, or employ inducible promoters like Pnis for controlled expression that minimizes potential toxic effects of membrane protein overexpression.

  • Vector Backbone: Select pWV01 derivatives that are stable in L. lactis and contain appropriate selection markers (e.g., erythromycin resistance) for maintaining the plasmid during cultivation.

  • Codon Optimization: While not always necessary for expression within the same species, codon optimization may improve expression levels, particularly for heterologous or synthetic variants of LcnC.

  • Signal Sequence Preservation: Maintain the native signal sequences and translational start signals to ensure proper membrane targeting and insertion.

  • Expression Verification: Include fusion tags that do not interfere with function (e.g., C-terminal His-tag) for detection and purification, or use antibody-based detection methods specific to LcnC.

  • Co-expression Strategies: Consider co-expressing LcnD on the same plasmid to ensure proper stoichiometry of the transport complex components.

Implementation of these strategies has been shown to yield functional expression of membrane proteins in L. lactis, making it possible to study their activities in their native cellular environment .

How can researchers engineer Lactococcus lactis strains to enhance bacteriocin production and transport through LcnC manipulation?

To engineer L. lactis strains with enhanced bacteriocin production and transport through LcnC manipulation:

  • Promoter Engineering: Replace native promoters controlling lcnC expression with stronger or inducible promoters to increase the abundance of transport complexes.

  • Operon Optimization: Adjust the stoichiometry of LcnC and LcnD expression by modifying ribosome binding sites or using separate promoters to achieve optimal ratios.

  • Protein Engineering Approaches:

    • Create chimeric transporters incorporating functional domains from more efficient ABC transporters

    • Introduce specific mutations to enhance ATP utilization efficiency

    • Modify substrate recognition domains to broaden the range of transportable bacteriocins

  • Metabolic Engineering: Enhance ATP production pathways to support increased transport activity, as LcnC requires ATP for function.

  • Secretion Signal Optimization: Modify the signal sequences of bacteriocins to improve their recognition and processing by the LcnC-LcnD transport system.

  • Immunity Enhancement: Strengthen immunity mechanisms to protect the producer strain from higher concentrations of its own bacteriocins.

  • Chassis Optimization: Select L. lactis strain backgrounds with favorable membrane composition and lower protease activity to improve protein stability and function.

How can recombinant Lactococcus lactis expressing LcnC be utilized in therapeutic protein delivery systems?

Recombinant L. lactis strains with optimized LcnC-based transport systems offer several advantages for therapeutic protein delivery:

  • Versatile Delivery Platform: By understanding and engineering the LcnC transport mechanism, researchers can develop L. lactis strains capable of efficiently secreting various therapeutic proteins beyond native bacteriocins.

  • Targeted Intestinal Delivery: L. lactis can deliver therapeutic proteins directly to intestinal tissues, as demonstrated in studies using L. lactis NCDO2118 to deliver anti-inflammatory proteins like p62 for treating inflammatory bowel diseases.

  • Dual-Function Therapeutics: Engineer strains that simultaneously produce bacteriocins (transported by native LcnC) and therapeutic proteins (using modified transport systems), creating antimicrobial and therapeutic effects in a single delivery vehicle.

  • Enhanced Secretion Efficiency: By optimizing LcnC and its partner proteins, researchers can improve the secretion efficiency of therapeutic proteins, leading to higher local concentrations at target sites.

  • Controlled Release Systems: Combine LcnC-based transport with inducible promoter systems to create drug delivery vehicles with controllable release profiles, potentially responsive to specific environmental signals in the gut.

The L. lactis NCDO2118 study demonstrated that recombinant strains producing human p62 protein significantly mitigated DSS-induced colitis in mice, reducing pro-inflammatory cytokines TNF and IFNγ expression and preserving intestinal barrier function. This provides a practical example of how engineered L. lactis strains can serve as effective mucosal delivery vehicles for therapeutic proteins .

What are the current limitations in studying LcnC function and how might these be overcome?

Several limitations currently challenge researchers studying LcnC function:

  • Protein Stability Issues:

    • Limitation: Membrane proteins like LcnC are often difficult to express and maintain in a stable, functional form.

    • Solution: Develop optimized buffer systems based on the intracellular ionic composition of L. lactis, as described in standardized assay studies. Consider using specific stabilizing agents that preserve membrane protein integrity.

  • Functional Assay Challenges:

    • Limitation: Direct measurement of transport activity is technically challenging.

    • Solution: Develop improved reporter systems such as fluorescently labeled bacteriocins that allow real-time monitoring of transport across the membrane.

  • Structural Information Gaps:

    • Limitation: Lack of high-resolution structural data for LcnC limits understanding of its mechanism.

    • Solution: Apply cryo-electron microscopy or advanced crystallization techniques optimized for membrane proteins to elucidate the structure of LcnC, particularly in complex with LcnD.

  • Complex Regulation:

    • Limitation: Understanding how LcnC expression and activity are regulated in response to environmental conditions remains incomplete.

    • Solution: Employ transcriptomic and proteomic approaches to map regulatory networks controlling LcnC expression under various conditions.

  • Heterologous Expression Challenges:

    • Limitation: Expression of functional LcnC in model organisms can be problematic.

    • Solution: Develop specialized expression hosts and protocols, considering that enzyme activities may differ significantly from previously published data when measured under conditions that more closely mimic the intracellular environment .

How do variations in LcnC protein affect the spectrum of bacteriocins that can be transported in different Lactococcus lactis strains?

Variations in the LcnC protein sequence across different L. lactis strains can significantly impact the spectrum of bacteriocins that can be efficiently transported:

  • Substrate Recognition Domains: Polymorphisms in regions of LcnC involved in recognizing bacteriocin leader sequences can alter substrate specificity. Even single amino acid substitutions in these domains may expand or restrict the range of bacteriocins recognized.

  • Transport Channel Characteristics: Variations in the transmembrane segments that form the transport channel can affect the size, charge, or hydrophobicity of bacteriocins that can be accommodated and transported.

  • Energy Coupling Efficiency: Differences in ATP-binding and hydrolysis domains may influence the energetic efficiency of the transport process, affecting the rate and yield of bacteriocin secretion.

  • Partner Protein Interactions: Variations in regions that mediate interaction with LcnD or other accessory proteins can impact the assembly and stability of the transport complex, indirectly affecting transport capabilities.

  • Regulatory Element Interactions: Some variations may affect interactions with regulatory proteins that modulate transport activity in response to environmental conditions.

To investigate these variations systematically, researchers could:

  • Compare the sequences of LcnC proteins from different L. lactis strains producing distinct bacteriocin profiles

  • Create chimeric LcnC proteins by domain swapping between variants

  • Test transport efficiency of various bacteriocins across these engineered strains

  • Correlate specific sequence variations with changes in bacteriocin transport specificity and efficiency

What novel approaches could advance our understanding of LcnC structure-function relationships?

Several innovative approaches could significantly advance our understanding of LcnC structure-function relationships:

  • Cryo-Electron Microscopy: Apply cryo-EM techniques to visualize the LcnC-LcnD complex in different conformational states during the transport cycle, providing insights into the dynamic aspects of bacteriocin transport.

  • Hydrogen-Deuterium Exchange Mass Spectrometry: Use HDX-MS to map conformational changes in LcnC upon substrate binding and during the transport process, identifying key regions involved in molecular recognition and movement.

  • Directed Evolution: Implement directed evolution approaches to generate LcnC variants with enhanced activity or altered substrate specificity, followed by sequence-function analysis to identify critical residues.

  • Computational Modeling: Develop refined computational models of LcnC structure based on homology with characterized ABC transporters, validated through experimental approaches like site-directed mutagenesis.

  • Single-Molecule Techniques: Apply single-molecule fluorescence resonance energy transfer (smFRET) to monitor conformational changes in real-time during the transport cycle.

  • Nanobody-Aided Crystallization: Use nanobodies that bind to and stabilize specific conformations of LcnC to facilitate crystallization and structural determination.

  • In-Cell NMR: Develop methodologies to study LcnC dynamics in its native membrane environment using in-cell NMR techniques.

These approaches would provide complementary insights into how the structure of LcnC relates to its function in bacteriocin transport, potentially enabling rational design of improved transport systems for both natural bacteriocins and recombinant therapeutic proteins .

How might systems biology approaches contribute to understanding the role of LcnC in the broader context of bacteriocin production and immunity?

Systems biology approaches offer powerful tools for understanding LcnC within the broader context of bacteriocin production and immunity:

  • Multi-omics Integration: Combine transcriptomics, proteomics, and metabolomics data to create comprehensive models of how LcnC expression and activity are integrated with other cellular processes, including:

    • Energy metabolism supporting ATP-dependent transport

    • Cell envelope maintenance during active bacteriocin secretion

    • Stress responses related to heterologous protein expression

  • Network Analysis: Map the regulatory networks controlling LcnC expression and identify key nodes that could be manipulated to enhance bacteriocin production and transport.

  • Flux Balance Analysis: Develop constraint-based models that predict how alterations in LcnC activity affect metabolic fluxes throughout the cell, helping to identify potential bottlenecks in bacteriocin production.

  • Ecological Modeling: Incorporate LcnC-mediated bacteriocin production into community-level models to understand its impact on microbial community dynamics and strain competition.

  • Quantitative Systems Pharmacology: For therapeutic applications, develop models that predict how engineered L. lactis strains with modified LcnC systems would behave in complex host environments.

  • Machine Learning Approaches: Apply machine learning to identify patterns in experimental data that may reveal non-obvious relationships between LcnC variants, bacteriocin production, and cellular physiology.

These approaches would help researchers move beyond studying LcnC in isolation to understanding its role within the complex network of cellular processes that collectively determine bacteriocin production efficiency and biological impact .

What potential exists for engineering LcnC to transport novel therapeutic proteins for medical applications?

The engineering of LcnC for transporting novel therapeutic proteins holds significant potential for medical applications:

  • Substrate Recognition Engineering: Modify the substrate recognition domains of LcnC to recognize and transport non-bacteriocin therapeutic proteins, potentially by creating fusion proteins with bacteriocin leader sequences.

  • Transport Efficiency Enhancement: Engineer LcnC variants with improved ATP utilization efficiency or faster transport kinetics to increase the yield of secreted therapeutic proteins.

  • Stability Improvements: Introduce mutations that enhance the stability of the LcnC-LcnD complex in the gastrointestinal environment, enabling more efficient in situ delivery of therapeutic proteins.

  • Inducible Transport Systems: Develop LcnC variants regulated by specific environmental triggers (e.g., pH, oxygen levels, or specific metabolites) to enable targeted activation of protein delivery in specific anatomical locations.

  • Multi-Protein Delivery Systems: Engineer LcnC to simultaneously transport multiple therapeutic proteins, creating synergistic treatment effects (e.g., anti-inflammatory proteins combined with tissue repair factors).

  • Responsive Delivery: Create feedback-regulated LcnC systems that modulate therapeutic protein delivery based on disease markers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.