Recombinant Lactococcus lactis subsp. lactis Multidrug resistance ABC transporter ATP-binding and permease protein (lmrA)

Shipped with Ice Packs
In Stock

Description

Transmembrane Architecture

LmrA possesses six putative transmembrane segments (TMS) complemented by a nucleotide binding domain . Each monomeric half of the transporter contains these six TMSs, which together form the substrate translocation pathway across the membrane when dimerized . Notably, cysteine scanning accessibility studies have provided valuable insights into the structural arrangement of these transmembrane regions.

Research utilizing fluorescein maleimide labeling experiments has demonstrated that several single cysteines in the predicted TMSs can be labeled by this bulky molecule, suggesting unrestricted accessibility via an aqueous pathway . The periodicity of fluorescein maleimide accessibility of residues 291 to 308 in TMS 6 revealed that this membrane-spanning alpha-helix has one face exposed to an aqueous cavity along its full length . This finding, together with the solvent accessibility of 11 of 15 membrane-embedded aromatic residues, indicates that the transmembrane domains form an aqueous chamber within the membrane under non-energized conditions, which is open to the intracellular environment .

The Alternating Two-Site Transport Model

LmrA operates through what researchers describe as an "alternating two-site transport mechanism," also metaphorically referred to as a "two-cylinder engine" . This model has been established through extensive research including equilibrium binding experiments, photoaffinity labeling, and drug transport assays .

The transport mechanism involves two critical drug-binding sites:

  1. A high-affinity, transport-competent site located on the inner membrane surface

  2. A low-affinity drug-release site positioned on the outer membrane surface

The interconversion between these two configurations is driven by ATP hydrolysis and proceeds via a catalytic transition state intermediate in which the drug transport site is occluded . This mechanism allows for the efficient extrusion of various compounds from the cell.

Experimental evidence supporting this model includes:

  • Determination of a stoichiometry of two molecules of vinblastine bound per transporter molecule of LmrA

  • Vinblastine equilibrium binding experiments demonstrating allosteric coupling between the two binding sites

  • Observation that only the low-affinity, outside-facing vinblastine-binding site is accessible in the ADP/vanadate-trapped LmrA transporter

Energy Coupling Mechanisms

The energy coupling to LmrA is more complex than initially anticipated. While ABC transporters traditionally derive metabolic energy solely from ATP binding and hydrolysis, LmrA demonstrates additional energy coupling mechanisms .

Research has identified several key aspects of LmrA's energy utilization:

  1. Proton-drug symport has been observed in certain conditions

  2. Sodium-motive force-dependent drug antiport occurs in the ATP-bound state

  3. Macroscopic ion currents have been detected in planar phospholipid bilayers for a truncated version of LmrA (termed LmrA-MD) containing the MD but lacking the NBD

These findings establish a more nuanced understanding of how LmrA utilizes different energy sources for substrate transport. Electrophysiological experiments with single-LmrA transporters in phospholipid bilayers have been instrumental in unraveling the sequence of steps in energy coupling .

Substrate Specificity and Transport

LmrA exhibits broad substrate specificity, functioning as a "hydrophobic vacuum cleaner" by excreting lipophilic cationic compounds from the inner leaflet of the membrane directly into the external water phase . This versatility allows LmrA to confer resistance to a wide variety of cationic lipophilic cytotoxic compounds and many clinically relevant antibiotics .

Interestingly, LmrA shares substrate specificity with MsbA, an essential ABC transporter in Escherichia coli involved in lipid trafficking . Studies have demonstrated that LmrA can functionally substitute for a temperature-sensitive mutant MsbA in E. coli at non-permissive temperatures, suggesting that LmrA could transport Lipid A . Additionally, LmrA exhibits Lipid A-stimulated, vanadate-sensitive ATPase activity .

The overlap in substrate specificity between these transporters is further evidenced by:

  • MsbA's ability to confer multidrug resistance on E. coli when expressed

  • MsbA's interaction with photoactivatable substrate [3H]azidopine

  • MsbA's display of daunomycin, vinblastine, and Hoechst 33342-stimulated vanadate-sensitive ATPase activity

  • MsbA's mediation of ethidium transport from cells and Hoechst 33342 in proteoliposomes

Expression Systems

Recombinant LmrA can be produced with various fusion tags to facilitate purification and characterization. Commonly, His-tagged versions of the protein are expressed in E. coli expression systems . The full-length protein (spanning amino acids 1-590) can be successfully expressed and purified for functional and structural studies .

Recent advances in recombinant protein production have made commercially available recombinant LmrA proteins accessible, as evidenced by products like the "Recombinant Lactococcus lactis subsp. lactis Multidrug resistance ABC transporter ATP-binding and permease protein (lmrA)" from suppliers like MyBioSource.com .

Purification and Characterization

Recombinant LmrA proteins can be purified using established chromatographic techniques. For His-tagged versions, affinity chromatography using metal chelation resins provides an efficient purification step . Typical specifications for commercially available recombinant LmrA include:

ParameterSpecification
SourceE. coli
TagHis
Protein LengthFull Length (1-590)
FormLyophilized powder
Purity>90% as determined by SDS-PAGE
Storage-20°C/-80°C, aliquoting necessary for multiple use
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol

Table 1: Specifications for recombinant LmrA protein .

For characterization, mass spectrometry techniques have been employed, including LC-MS/MS using Dionex Ultimate 3000 RSLC nanoUPLC systems and Q Exactive Orbitrap mass spectrometers . Additionally, functional assays examining ATPase activity and transport capabilities provide important insights into the activity of the recombinant protein.

Homology with Human P-glycoprotein

One of the most significant aspects of LmrA is its structural and functional homology to the human multidrug resistance P-glycoprotein (also known as MDR1 or ABCB1), overexpression of which is one of the major causes of resistance of cancers to chemotherapy . This homology makes LmrA an excellent model system for studying multidrug resistance mechanisms relevant to human health.

Key similarities between LmrA and P-glycoprotein include:

  • Functional substitution capacity: Bacterial LmrA can substitute for P-glycoprotein in human lung fibroblast cells

  • Similar drug and modulator specificity

  • Shared transport mechanisms

  • Analogous structural organization

Published data for P-glycoprotein, including biphasic fluorescence quenching by transport substrates, stimulation of photoaffinity labeling by transport substrates, and reduced efficiency of photoaffinity labeling with drug analogs after vanadate trapping, are consistent with the two-site model established for LmrA .

Relationship with Other Bacterial Transporters

While LmrA is a major player in multidrug resistance in L. lactis, other transporters also contribute to this phenotype. Notably, LmrCD is another heterodimeric MDR ABC transporter in L. lactis that has been identified as a major determinant of both acquired and intrinsic drug resistance .

Comparison of MDR transporters in L. lactis:

TransporterTypeFunctionRegulation
LmrAABC transporter (homodimer)Mediates drug and antibiotic resistance-
LmrCDABC transporter (heterodimer)Major determinant of acquired and intrinsic drug resistanceRegulated by LmrR (YdaF), a local transcriptional repressor
LmrPMajor facilitatorProton/drug antiporter-

Table 2: Comparison of multidrug resistance transporters in L. lactis .

In-silico analysis of the L. lactis genome indicates the presence of at least 40 putative MDR transporters, though only four (LmrA, LmrC, LmrD, and LmrP) have been experimentally associated with the MDR phenotype .

It's worth noting that in Bacillus subtilis, a protein also named LmrA serves a different function, acting as a repressor of the lmrAB and yxaGH operons rather than as a transporter .

Role in Antibiotic Resistance

LmrA's ability to confer resistance to various antibiotics has significant implications for understanding bacterial resistance mechanisms. The protein's broad substrate specificity allows it to extrude multiple classes of antibiotics, contributing to the multidrug resistance phenotype in L. lactis .

Research has demonstrated that LmrA plays a role in resistance to:

  • Lincomycin

  • Puromycin

  • Various lipophilic antibiotics

The probiotic properties of L. lactis strains are related to their ability to survive in the gastrointestinal environment, which may be partially attributed to transporters like LmrA . Recent studies on L. lactis strains isolated from natural whey starter cultures have highlighted their potential probiotic properties, including high values of hydrophobicity and auto-aggregation, which could be influenced by membrane proteins like LmrA .

Potential Biotechnological Applications

The detailed understanding of LmrA's structure and function has opened avenues for potential biotechnological applications:

  1. Model system for drug resistance studies: LmrA serves as an excellent model for understanding multidrug resistance mechanisms applicable to human cancer treatments due to its homology with P-glycoprotein .

  2. Drug discovery platform: The alternating two-site model provides a basis for the development of compounds that can inhibit multidrug transporters, potentially overcoming resistance in bacterial infections and cancer treatments .

  3. Recombinant protein applications: The availability of purified recombinant LmrA enables structural studies and functional assays that can advance our understanding of membrane transport processes .

  4. Probiotic development: Understanding the role of transporters like LmrA in bacterial survival can contribute to the development of enhanced probiotic strains with improved gastrointestinal survival capabilities .

The discovery that LmrA and MsbA have overlapping substrate specificities implies the presence of structural elements that support drug-protein interactions and suggests a possible role for LmrA in lipid trafficking in L. lactis . This finding expands our understanding of the physiological roles of these transporters beyond simply drug resistance.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lmrA; LL0711; L116532; Multidrug resistance ABC transporter ATP-binding and permease protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-590
Protein Length
full length protein
Species
Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Target Names
lmrA
Target Protein Sequence
MERGPQMANRIEGKAVDKTSIKHFIKLIRAAKPRYLFFIIGILAGIVGTLIQLQVPKMVQ PLVNSFGHGVNGGKVALVIALYIGSAAVSAIAAIVLGIFGESVVKNLRTRVWDKMIHLPV KYFDEVKTGEMSSRLANDTTQVKNLIANSIPQAFTSILLLVGSIVFMLQMQWRLTLAMII AVPVVMLIMFPIMTFGQKIGRTRQDSLANFQGIASESLSEIRLVKSSNAEKQASKKAEND VNALYKIGVKEAIFDGLMSPVMMLSMMLMIFGLLAYGIYLISTGVMSLGTLLGMMMYLMN LIGAVPTVATFFTELAKASGSTGRLTELLDEEQEVLHQGESLDLEGKTLSARHVDFAYDD SEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLEN WRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEV GERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLV IAHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAKYVSEQLTVGQ
Uniprot No.

Target Background

Function
LmrA acts as an efflux transporter for a variety of amphiphilic cationic compounds, including antibiotics.
Gene References Into Functions
  1. An analysis of the effect of detergents on the activity of the ABC transporter LmrA. PMID: 21651889
  2. A carboxylate plays a critical role in proton conduction by the ATP-binding cassette multidrug transporter LmrA. PMID: 16040836
  3. LmrA-mediated Hoechst 33342 transport in membrane vesicles is influenced by the transmembrane pH gradient due to a pH-dependent partitioning of Hoechst 33342 into the membrane. PMID: 16363806
  4. A remodeled structure of LmrA using the atomic coordinates of the MsbA homologue Sav1866 from Staphylococcus aureus is reported. PMID: 17624317
  5. The membrane domain of LmrA mediates an ethidium/proton co-transport reaction, suggesting functional similarities in the mechanism of secondary-active and ABC transporters. PMID: 14685244
  6. LmrA mediates the reverse uptake of ethidium in ATP-depleted cells in the presence of an inwardly directed ethidium concentration gradient. LmrA-mediated uptake of ethidium is coupled to the catalytic cycle in the direction of ATP synthesis. PMID: 14660649

Show More

Hide All

Database Links

KEGG: lla:L116532

STRING: 272623.L116532

Protein Families
ABC transporter superfamily, Multidrug exporter LmrA (TC 3.A.1.117.1) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is LmrA and what is its function in Lactococcus lactis?

LmrA is an ATP-binding cassette (ABC) transporter from Lactococcus lactis that functions as a multidrug efflux pump. It belongs to the ABC superfamily of transport proteins and confers resistance to a wide variety of cationic lipophilic cytotoxic compounds and clinically relevant antibiotics . While LmrA has no known physiological substrate in L. lactis, it serves as a protective mechanism against toxic compounds by exporting them from the cell membrane to the external environment .

LmrA functions as a "hydrophobic vacuum cleaner" by excreting lipophilic cationic compounds from the inner leaflet of the membrane directly into the external water phase . Recent research has also revealed that LmrA can transport NaCl via an H+-Na+-Cl- symport mechanism, suggesting a potential physiological role in salt stress response .

How does LmrA's structure relate to its function as a multidrug transporter?

LmrA is structured as a half ABC transporter that is functional as a homodimer, consistent with the general four-domain organization of ABC transporters . This quaternary structure is crucial for its function, as it creates the complete transport pathway necessary for substrate movement. The protein is proposed to mediate drug transport by an alternating two-site transport mechanism .

The structural arrangement of LmrA includes transmembrane domains that form the substrate translocation pathway and nucleotide-binding domains that bind and hydrolyze ATP to power conformational changes necessary for transport. This structure enables LmrA to recognize and transport a diverse range of substrates, contributing to its role in multidrug resistance . The homodimeric nature of LmrA creates a functional unit that resembles the four-domain structure of full ABC transporters like human P-glycoprotein.

What energy sources does LmrA utilize for substrate transport?

LmrA displays remarkable flexibility in energy utilization for transport. Even though it primarily functions as an ATP-dependent transporter, research has shown that LmrA can also use the proton-motive force to transport substrates across the membrane through a reversible, H+-dependent, secondary-active transport mechanism .

A study published in PLOS One demonstrated that LmrA can transport ethidium bromide using proton-motive force, and it can also transport NaCl by mediating apparent H+-Na+-Cl- symport . This dual energy utilization mechanism makes LmrA particularly interesting for understanding the fundamental bioenergetics of ABC transporters. The ability to switch between primary (ATP-dependent) and secondary (proton-motive force-dependent) transport modes may provide adaptability in responding to various cellular stress conditions .

What is the relationship between LmrA and other multidrug transporters?

LmrA is both functionally and structurally homologous to the human multidrug transporter P-glycoprotein (ABCB1/MDR1) . Studies have shown that LmrA can functionally replace human ABCB1 in lung fibroblast cells, indicating substantial conservation of transport mechanisms across species . This functional conservation makes LmrA an important model system for studying the molecular basis of multidrug transport.

In the context of Lactococcus lactis, it's important to note that this organism produces multiple distinct multidrug transporters. Besides LmrA, L. lactis also produces LmrP, a proton/drug antiporter belonging to the major facilitator superfamily of secondary transporters . Additionally, LmrCD, a heterodimeric MDR ABC transporter, has been identified as a major determinant of both acquired and intrinsic drug resistance in L. lactis . Comparative studies between these transporters provide insights into the diversity of mechanisms underlying multidrug resistance.

How does the expression of recombinant LmrA affect bacterial survival under stress conditions?

Expression of recombinant LmrA has significant impacts on bacterial survival under stress conditions. Research published in PLOS One demonstrated that LmrA activity significantly enhances survival of high-salt adapted lactococcal cells during ionic downshift . This finding suggests a novel physiological role for LmrA beyond drug resistance.

The ability of LmrA to transport salt (via H+-Na+-Cl- symport) provides a mechanism for bacteria to respond to osmotic stress. By modulating intracellular ion concentrations, LmrA-expressing cells can better adapt to changing environmental conditions. This function represents an unexpected aspect of ABC transporter biology that extends beyond the classical view of these proteins as drug efflux pumps .

For researchers, this suggests that recombinant LmrA expression systems should be evaluated not only for drug transport capacity but also for their ability to influence bacterial physiology under various stress conditions.

What techniques are most effective for studying LmrA's transport mechanism?

Multiple complementary techniques have proven effective for elucidating LmrA's transport mechanisms:

  • Electrophysiological experiments: These have been successfully employed to analyze substrate transport by purified LmrA. The 2009 PLOS One study represented the first use of electrophysiological techniques to analyze substrate transport by a purified multidrug transporter .

  • Radioactive ion transport studies: Tracking the movement of radioactively labeled ions has provided insights into LmrA's role in salt transport .

  • Fluorescent ion-selective probes: These allow real-time monitoring of transport activities in intact cells or membrane vesicles .

  • Photoaffinity labeling: This technique has been used with transported drug analogs to identify specific protein domains and regions involved in substrate binding and transport .

  • ATP hydrolysis assays: These measure the ATPase activity of purified LmrA to establish correlations between ATP consumption and transport activity .

The combination of these approaches has revealed LmrA's dual transport mechanisms (ATP-dependent and proton-motive force-dependent) and its ability to transport both drugs and physiological substrates like salt.

What are key considerations when designing a Last Minute Risk Analysis (LMRA) for laboratory work with LmrA?

When working with recombinant LmrA in laboratory settings, implementing a Last Minute Risk Analysis (LMRA) protocol is crucial for safety. An LMRA should be performed at the workplace before beginning experimental work with LmrA, especially when handling potentially hazardous materials .

Key considerations include:

  • Timing of assessment: Perform the LMRA after a Permit to Work has been issued but before work actually begins, and repeat whenever the situation changes .

  • Location: Conduct the assessment at the workplace or in its immediate vicinity, as this is where potential dangers may be encountered .

  • Purpose: The LMRA should create awareness and exclude potential risks specific to working with recombinant proteins and associated chemicals .

  • Consultation process: If any doubts concerning health and safety arise, always consult with a supervisor who can assess the situation and implement necessary safety measures .

  • Documentation: Use a short checklist covering common subjects relevant to the specific procedures, but ensure it isn't merely a box-ticking exercise—substantive discussion of risks is essential .

How can researchers optimize expression systems for functional studies of recombinant LmrA?

Optimizing expression systems for LmrA requires careful consideration of several factors:

  • Host selection: Since LmrA is a membrane protein from Lactococcus lactis, it may be more appropriate to express it in a Gram-positive bacteria host. The 2017 iGEM team from RDFZ-China chose Bacillus subtilis as a host for LmrA expression since it is a well-studied Gram-positive bacterium that is non-pathogenic, which restricts potential dangers associated with using LmrA .

  • Expression control: Implementing tight regulatory control of expression is crucial, as overexpression of membrane transporters can be toxic to host cells. Inducible promoter systems allow for controlled expression timing.

  • Membrane integration: As LmrA is a membrane protein, proper folding and integration into the host membrane is essential for functionality. Expression systems that facilitate correct membrane targeting and insertion should be prioritized.

  • Functional verification: Researchers should incorporate transport assays to verify that the recombinant LmrA is functionally active in the chosen expression system, particularly if the goal is to study transport kinetics or substrate specificity .

What approaches are recommended for investigating LmrA's role in antimicrobial resistance?

To investigate LmrA's role in antimicrobial resistance, researchers should consider:

  • Gene deletion/knockout studies: Creating LmrA deletion mutants and comparing their drug susceptibility profiles to wild-type strains. Research has shown that deletion of similar transporters (like LmrCD) renders L. lactis sensitive to several toxic compounds .

  • Overexpression studies: Examining how controlled overexpression of LmrA affects minimum inhibitory concentrations (MICs) of various antibiotics.

  • Transport assays: Measuring the efflux of fluorescent substrates (such as ethidium bromide) or radioactively labeled antibiotics in cells expressing different levels of LmrA.

  • Transcriptional analysis: Investigating how exposure to antibiotics affects LmrA expression. For example, global transcriptome analysis comparing drug-resistant strains with wild-type strains can reveal patterns of regulation, as was done with LmrCD .

  • Regulatory studies: Identifying transcriptional regulators of LmrA expression, similar to how LmrR (YdaF) was identified as a local transcriptional repressor of LmrCD that belongs to the PadR family of transcriptional regulators .

How should researchers interpret conflicting data regarding LmrA's transport mechanisms?

When faced with conflicting data about LmrA's transport mechanisms, researchers should:

  • Consider methodological differences: Different experimental approaches (electrophysiology, transport assays, ATPase activity measurements) may yield apparently contradictory results due to their inherent limitations. For example, electrophysiological techniques provided novel insights into LmrA's salt transport function that weren't evident from traditional transport assays .

  • Examine experimental conditions: Differences in pH, temperature, membrane composition, or energy status can dramatically affect LmrA's transport mode. The dual capacity for ATP-dependent and proton-motive force-dependent transport means that different energy sources may dominate under different conditions .

  • Account for substrate specificity: LmrA shows different kinetics and mechanisms depending on the substrate. While it transports some drugs via an ATP-dependent mechanism, other substrates like ethidium bromide and salt can be transported via proton-coupled mechanisms .

  • Consider physiological context: In vivo conditions may differ substantially from purified systems. The finding that LmrA enhances survival during salt stress highlights how physiological roles may not be immediately obvious from in vitro studies .

  • Integrate structural data: Connecting functional observations with structural information about conformational changes can help reconcile seemingly contradictory transport mechanisms.

What controls are essential when conducting LmrA transport assays?

Rigorous controls are crucial for reliable LmrA transport studies:

  • Negative controls: Include membrane vesicles or cells without LmrA expression to establish baseline transport activity from endogenous transporters.

  • Inactive mutant controls: Utilize LmrA variants with mutations in critical functional regions (e.g., in the Walker A or B motifs of the nucleotide-binding domains) that should display dramatically reduced transport activity.

  • Energy coupling controls: Include conditions that selectively eliminate either ATP-dependent transport (ATP depletion) or proton-motive force-dependent transport (proton ionophores) to distinguish between these mechanisms .

  • Substrate specificity controls: Test known substrates alongside experimental compounds to verify assay functionality.

  • System viability controls: Ensure that the expression system remains viable and that membrane integrity is maintained throughout the experiment, as membrane damage can cause false-positive results in transport assays.

By implementing these controls, researchers can more confidently interpret results from LmrA transport studies and distinguish genuine transport phenotypes from experimental artifacts.

What are promising areas for future research on LmrA and related multidrug transporters?

Several promising research directions for LmrA include:

  • Structural studies: While functional aspects of LmrA have been characterized, high-resolution structural data during different stages of the transport cycle would provide crucial insights into its mechanism. The application of cryo-electron microscopy could be particularly valuable for capturing different conformational states.

  • Physiological role clarification: Further investigation into LmrA's role in salt transport and stress response could reveal previously unappreciated physiological functions of multidrug transporters .

  • Regulatory network mapping: Understanding how LmrA expression is regulated in response to various environmental stresses could reveal integration with broader cellular stress responses, similar to what has been observed with LmrCD and its regulator LmrR .

  • Substrate recognition determinants: Detailed mapping of substrate binding sites through mutagenesis and computational modeling could reveal how LmrA achieves poly-specificity while maintaining transport efficiency.

  • Energy coupling mechanisms: Further characterization of how LmrA couples ATP hydrolysis and proton gradients to substrate movement would contribute to fundamental understanding of ABC transporter bioenergetics .

How might LmrA research inform strategies to combat antimicrobial resistance?

Research on LmrA has significant implications for addressing antimicrobial resistance:

  • Inhibitor development: Understanding LmrA's structure and mechanism could facilitate the design of specific inhibitors that might be combined with antibiotics to increase their efficacy against resistant bacteria.

  • Resistance prediction: Knowledge of how LmrA and related transporters contribute to intrinsic and acquired resistance can help predict potential resistance mechanisms for new antibiotics during development.

  • Diagnostic tools: The finding that LmrA expression is often upregulated in drug-resistant strains suggests that transporters could serve as biomarkers for resistance, potentially leading to molecular diagnostic tools.

  • Cross-resistance patterns: Understanding the substrate specificity of LmrA helps explain patterns of cross-resistance to multiple antibiotics and could inform more effective antibiotic rotation or combination strategies.

The structural and functional similarities between LmrA and human MDR transporters like P-glycoprotein also mean that insights from LmrA research could inform approaches to overcome multidrug resistance in cancer, making this bacterial transporter relevant beyond the field of antimicrobial resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.