Recombinant Lactococcus lactis subsp. lactis Nisin biosynthesis sensor protein nisK (nisK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nisK; Nisin biosynthesis sensor protein NisK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-447
Protein Length
full length protein
Species
Lactococcus lactis subsp. lactis (Streptococcus lactis)
Target Names
nisK
Target Protein Sequence
MGKKYSMRRRIWQAVIEIIIGTCLLILLLLGLTFFLRQIGQISGSETIRLSLDSDNLTIS DIERDMKHYPYDYIIFDNDTSKILGGHYVKSDVPSFVASKQSSHNITEGEITYTYSSNKH FSVVLRQNSMPEFTNHTLRSISYNQFTYLFFFLGEIILIIFSVYHLIREFSKNFQAVQKI ALKMGEITTFPEQEESKIIEFDQVLNNLYSKSKELAFLIEAERHEKHDLSFQVAALSHDV KTPLTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLNDENDYKAT ISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLALSRALINIFVNACQYAKE GEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKKNAGKLFFTEDTGRSGKHYGIGLSFAQG VALKHQGNLILSNPQKGGAEVILKIKK
Uniprot No.

Target Background

Function

NisK is a member of the two-component NisK/NisR regulatory system involved in nisin lantibiotic biosynthesis regulation. It functions as a membrane-associated protein kinase, phosphorylating NisR in response to environmental cues.

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NisK and what is its fundamental role in nisin biosynthesis?

NisK is a histidine kinase (HK) that functions as a sensor protein in Lactococcus lactis. It constitutes one half of the NisRK two-component regulatory system that controls nisin biosynthesis. NisK specifically senses the presence of nisin and subsequently activates NisR, which in turn induces the transcription of genes required for nisin biosynthesis and immunity . Unlike most peptide-sensing histidine kinases that contain multiple transmembrane segments, NisK has only two transmembrane segments with a large extracellular region that recognizes nisin as a ligand . This recognition mechanism represents a relatively rare type of peptide-sensing among histidine kinases and makes NisK particularly interesting for research.

What specific residues in the NisK sensor region are critical for nisin recognition?

Mutagenesis studies combined with reporter strain analyses have identified key residues in the NisK extracellular domain that are crucial for nisin recognition and signal transduction . Several hydrophobic residues, including two aromatic amino acids in the extracellular region, play essential roles in sensing nisin and regulating biosynthesis . The first β-strand of the extracellular domain, which is rich in hydrophobic amino acids, is particularly important for nisin recognition . Additionally, a negatively charged residue in this first β-strand contributes significantly to nisin biosynthesis regulation . Protein binding analyses have confirmed that nisin cannot interact with NisK mutants where these key residues are altered, demonstrating their direct involvement in nisin recognition . These findings provide valuable targets for protein engineering approaches aimed at enhancing nisin detection sensitivity or modifying the specificity of the NisK sensor.

How is the subcellular localization of NisK related to the assembly of the nisin biosynthesis machinery?

Fluorescence microscopy studies have revealed important insights into the subcellular organization of the nisin biosynthesis machinery in L. lactis . While NisK's specific localization is not directly stated in the search results, the research indicates that components of the nisin biosynthesis machinery exhibit distinct localization patterns. Precursor nisin, NisB, and NisC primarily localize at the cell poles, with a preference for the old poles, forming a nisin modification complex . In contrast, the transporter NisT was found to be distributed uniformly and circumferentially in the membrane . These findings suggest a spatial organization where different components of the nisin biosynthesis pathway occupy distinct subcellular compartments. This spatial organization likely facilitates the sequential processing of nisin from precursor synthesis to modification and export, with NisK presumably positioned to effectively sense external nisin and regulate the process through its interaction with NisR.

What mechanisms explain the interaction between NisK and nisin at the molecular level?

The molecular mechanism of NisK-nisin interaction involves specific recognition of nisin by the extracellular domain of NisK. Research suggests that hydrophobic interactions play a crucial role in this recognition process, with the first β-strand of the NisK extracellular domain being particularly important . The five lanthionine rings in nisin's structure (34 amino acids total) appear to interact with specific regions in NisK's extracellular domain . Protein binding analyses have confirmed direct interaction between nisin and wild-type NisK, while this interaction is abolished in key NisK mutants . The sensing mechanism is relatively unusual among peptide-sensing histidine kinases, as NisK has only two transmembrane segments with a large extracellular domain, whereas most peptide-sensing HKs have multiple transmembrane segments . This unique structural arrangement allows NisK to effectively detect nisin in the extracellular environment and trigger the signaling cascade necessary for nisin biosynthesis regulation.

What are the optimal conditions for expressing and purifying recombinant NisK protein?

For optimal expression and purification of recombinant NisK protein, researchers typically use E. coli as an expression host with an N-terminal His-tag to facilitate purification . The recombinant protein includes the full-length NisK (amino acids 1-447) and is generally purified to greater than 90% purity as determined by SDS-PAGE . After purification, the protein is usually prepared as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

For reconstitution and storage, the following protocol is recommended:

  • Briefly centrifuge the vial containing lyophilized protein before opening

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration, with 50% being standard) to prevent freeze-thaw damage

  • Aliquot for long-term storage at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

This protocol ensures the preservation of NisK's structural integrity and functional properties for experimental use.

How can researchers effectively measure NisK-nisin interactions experimentally?

Researchers can employ several complementary approaches to measure and characterize NisK-nisin interactions:

  • Reporter Strain Systems: Construct a reporter L. lactis strain with nisRK constitutively expressed and a reporter gene (such as lacZ) under the control of the nisin-inducible promoter PnisA . This system allows for quantitative measurement of NisK activation by nisin through colorimetric or fluorometric detection of reporter gene expression.

  • Protein Binding Analyses: Direct protein binding assays can determine the physical interaction between purified NisK (or its extracellular domain) and nisin . These analyses can identify whether specific mutations in NisK disrupt nisin binding.

  • Mutagenesis Studies: Systematic mutagenesis of conserved residues in the NisK extracellular domain, combined with functional assays, can identify specific amino acids crucial for nisin recognition .

  • Fluorescence Microscopy: Using fluorescently labeled components to visualize the interactions between NisK and other components of the nisin biosynthesis machinery in vivo .

These methodologies provide complementary data on the kinetics, specificity, and structural requirements of NisK-nisin interactions, facilitating a comprehensive understanding of the sensing mechanism.

What genetic engineering strategies can enhance NisK function for improved nisin production?

Several genetic engineering strategies have proven effective for enhancing NisK function and improving nisin production:

  • Gene Copy Number Amplification: Introducing multiple copies of the nisRK genes through serial genetic re-transformations significantly increases nisin production . This approach addresses the naturally low expression levels of nisRK genes in wild-type L. lactis.

  • Promoter Engineering: Replacing the native promoter of nisRK with stronger constitutive promoters can increase expression levels and enhance sensitivity to nisin .

  • Site-Directed Mutagenesis: Based on knowledge of key residues in the NisK sensor domain, targeted mutations can potentially enhance nisin sensitivity or alter specificity .

  • Co-expression Strategies: Simultaneous expression of different nisin variants (e.g., nisA and nisZ) in the same strain can potentiate antimicrobial activity .

A proven protocol involves multiple rounds of transformation:

  • Transform wild-type L. lactis with plasmids containing nisA and nisRK genes

  • Select colonies based on antibiotic resistance and gene copy number

  • Use clones with the highest copy numbers for subsequent transformation rounds

  • Perform additional transformations to further increase gene dosage

This approach has resulted in significant increases in nisin production and enhanced antimicrobial activity against foodborne pathogens .

How can qPCR analysis be optimized for quantifying nisRK gene expression in different L. lactis strains?

Quantitative PCR (qPCR) analysis is a valuable tool for measuring nisRK gene expression in different L. lactis strains. For optimal results, researchers should:

  • Design primers specific to conserved regions of the nisR and nisK genes to ensure reliable amplification

  • Select appropriate reference genes that show stable expression across experimental conditions for normalization

  • Establish standard curves using known quantities of target genes to enable absolute quantification

  • Extract RNA under standardized conditions to minimize variation between samples

  • Include appropriate controls to verify the absence of genomic DNA contamination

Studies have successfully used qPCR to demonstrate that nisA and nisRK genes are expressed at relatively low levels in wild-type L. lactis strains, and to quantify increases in expression following genetic modifications . This technique provides valuable data on the relationship between nisRK expression levels and nisin production capacity.

What approaches help resolve contradictory findings in studies of NisK function and nisin biosynthesis?

When researchers encounter contradictory findings regarding NisK function or nisin biosynthesis, several analytical approaches can help resolve these discrepancies:

  • Strain-Specific Differences: Carefully document and compare the genetic backgrounds of L. lactis strains used in different studies, as natural variations can affect NisK function and nisin production .

  • Methodological Standardization: Standardize experimental conditions, including growth media, temperature, pH, and induction parameters, to enable direct comparison between studies.

  • Multi-Technique Verification: Employ complementary techniques to verify findings. For example, combine genetic analyses with protein-level studies and functional assays to provide a more complete picture .

  • Quantitative Analysis: Use quantitative methods like qPCR for gene expression and HPLC for nisin quantification to replace qualitative observations with precise measurements .

  • In Vivo vs. In Vitro Considerations: Recognize that in vitro observations may not always translate to in vivo conditions due to the complex cellular environment where NisK functions .

By applying these approaches, researchers can better understand the source of contradictory findings and establish a more coherent model of NisK function in nisin biosynthesis.

What emerging techniques could advance our understanding of NisK's role in nisin biosynthesis?

Several emerging techniques show promise for advancing our understanding of NisK's role in nisin biosynthesis:

  • Cryo-Electron Microscopy: This technique could provide high-resolution structural information about NisK, particularly in complex with nisin or other components of the biosynthesis machinery.

  • Advanced Fluorescence Techniques: Super-resolution microscopy and single-molecule tracking could reveal dynamic aspects of NisK function and interactions with other components of the nisin biosynthesis machinery with unprecedented spatial and temporal resolution .

  • Synthetic Biology Approaches: Designer circuits incorporating modified versions of the NisRK system could provide insights into the signal transduction mechanism and potentially create novel biosensors.

  • Systems Biology Integration: Combining transcriptomics, proteomics, and metabolomics data could provide a holistic understanding of how NisK regulates the entire nisin biosynthesis pathway in response to various environmental conditions.

  • Computational Modeling: Molecular dynamics simulations could predict how specific mutations might affect NisK-nisin interactions and guide experimental design.

These approaches would complement existing research methodologies and potentially resolve current gaps in our understanding of NisK function.

How might engineered NisK variants contribute to the development of novel antimicrobial applications?

Engineered NisK variants could contribute significantly to novel antimicrobial applications in several ways:

  • Enhanced Sensitivity: NisK variants with increased sensitivity to nisin could improve production yields in industrial settings .

  • Altered Specificity: Modified NisK sensors that recognize nisin variants or other lantibiotics could enable the production of novel antimicrobial compounds with different target specificities.

  • Biosensor Development: Engineered NisK-based biosensors could detect the presence of specific lantibiotics in food products or clinical samples with high sensitivity and specificity.

  • Controlled Expression Systems: The NisRK regulatory system could be adapted for controlled expression of therapeutic proteins or antimicrobial peptides in response to specific signals.

  • Synthetic Biology Applications: NisK variants could become components of synthetic circuits designed to respond to specific environmental conditions, potentially creating probiotic strains with dynamic antimicrobial production capabilities.

Recent research showing successful bioengineering of L. lactis strains with enhanced nisin production through nisRK modification demonstrates the feasibility of such approaches . As our understanding of the structure-function relationship of NisK improves, more sophisticated engineering strategies will likely emerge.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.