Recombinant Lactococcus lactis subsp. lactis Nisin transport ATP-binding protein NisT (nisT)

Shipped with Ice Packs
In Stock

Description

Role in Nisin Biosynthesis

Nisin is synthesized as a precursor peptide (NisA) comprising a leader peptide and core peptide. NisT collaborates with modification enzymes NisB (dehydratase) and NisC (cyclase) in a tightly regulated process:

Process StepKey Findings
DehydrationNisB dehydrates serine/threonine residues in NisA .
CyclizationNisC forms lanthionine bridges, stabilizing nisin’s structure .
TransportNisT secretes modified prenisin; deletion abolishes secretion .
Leader Peptide CleavageExtracellular protease NisP removes the leader, activating mature nisin .

Mutant studies reveal that NisT-deficient strains accumulate intracellular nisin, causing growth inhibition due to toxicity .

Transport Kinetics and Enzyme Interactions

In vitro ATPase assays and in vivo secretion studies demonstrate how NisB and NisC modulate NisT’s activity:

Table 1: ATPase Activity of NisT Under Different Conditions

ConditionATPase Rate (nmol·min⁻¹·mg⁻¹)Substrate/Enzyme Effect
Basal Activity62.5 ± 9.4None
+ NisB54.7 ± 4.5No significant change
+ NisC59.3 ± 4.9No significant change
+ NisB + NisC49.3 ± 4.41.3-fold reduction (statistically insignificant)
+ NisB + NisC + NisA LPSlight increaseNon-concentration-dependent stimulation
+ NisB + NisC + mNisAMild inhibitionNon-concentration-dependent inhibition

Key findings:

  • NisB enhances NisT’s secretion efficiency by ~3.9-fold in vivo, suggesting substrate channeling between enzymes .

  • ATP hydrolysis is essential for transport; mutations in ATPase motifs (e.g., H551A) abolish secretion .

Recombinant Production and Applications

Recombinant NisT is commercially available for research (e.g., MyBioSource, Creative Biomart) with the following specifications :

Table 2: Recombinant NisT Variants

SupplierHostPurityTagApplications
MyBioSourceE. coli≥85%HisSDS-PAGE, enzyme assays
Creative BiomartE. coli≥90%HisStructural studies

Applications include:

  • Mechanistic Studies: Elucidating ABC transporter dynamics and lanthipeptide secretion .

  • Biopreservation Engineering: Optimizing nisin production in industrial strains .

Research Implications

  • Enzyme Synergy: NisB acts as a bridge between NisC and NisT, enhancing transport efficiency .

  • Substrate Specificity: Unmodified NisA is poorly secreted, emphasizing the need for post-translational modifications .

  • Biotechnological Potential: Recombinant NisT enables high-yield nisin production for food preservation and antimicrobial therapies .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nisT; Nisin transport ATP-binding protein NisT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-600
Protein Length
full length protein
Species
Lactococcus lactis subsp. lactis (Streptococcus lactis)
Target Names
nisT
Target Protein Sequence
MDEVKEFTSKQFFYTLLTLPSTLKLIFQLEKRYAIYLIVLNAITAFVPLASLFIYQDLIN SVLGSGRHLINIIIIYFIVQVITTVLGQLESYVSGKFDMRLSYSINMRLMRTTSSLELSD YEQADMYNIIEKVTQDSTYKPFQLFNAIIVELSSFISLLSSLFFIGTWNIGVAILLLIVP VLSLVLFLRVGQLEFLIQWQRASSERETWYIVYLLTHDFSFKEIKLNNISNYFIHKFGKL KKGFINQDLAIARKKTYFNIFLDFILNLINILTIFAMILSVRAGKLLIGNLVSLIQAISK INTYSQTMIQNIYIIYNTSLFMEQLFEFLKRESVVHKKIEDTEICNQHIGTVKVINLSYV YPNSNAFALKNINLSFEKGELTAIVGKNGSGKSTLVKIISGLYQPTMGIIQYDKMRSSLM PEEFYQKNISVLFQDFVKYELTIRENIGLSDLSSQWEDEKIIKVLDNLGLDFLKTNNQYV LDTQLGNWFQEGHQLSGGQWQKIALARTFFKKASIYILDEPSAALDPVAEKEIFDYFVAL SENNISIFISHSLNAARKANKIVVMKDGQVEDVGSHDVLLRRCQYYQELYYSEQYEDNDE
Uniprot No.

Target Background

Function

Putative involvement in the export process of the lantibiotic nisin.

Protein Families
ABC transporter superfamily, Nisin exporter (TC 3.A.1.111.3) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of NisT in nisin biosynthesis?

NisT functions as a dedicated ATP-binding cassette (ABC) transporter that secretes prenisin (nisin precursor) from Lactococcus lactis cells. It works in concert with NisB (dehydratase) and NisC (cyclase), which modify the ribosomally synthesized nisin precursor peptide. As demonstrated in kinetic analyses of nisin production, NisT is responsible for releasing prenisin from the cell into the medium before the processing of the leader sequence occurs. Studies with L. lactis strains lacking nisT show no secretion of prenisin, confirming that NisT is essential for the export process .

The experimental approach to determine NisT function typically involves gene deletion studies where nisT is removed from the nisin gene cluster. Researchers can then analyze the cellular location of prenisin (intracellular vs. extracellular) to confirm the transport function. Additionally, complementation studies with functional nisT can verify its specific role in transport.

How does NisT interact with other nisin biosynthesis proteins?

NisT interacts significantly with the modification enzyme NisB in a functional relationship that enhances transport efficiency. Research has shown that the efficiency of prenisin transport by NisT is markedly enhanced by NisB, suggesting a channeling mechanism of prenisin transfer between the nisin modification enzymes and the transporter . This interaction appears to be specific, as studies demonstrate that:

  • When NisB is deleted, production of prenisin is nearly completely abolished

  • When NisC is deleted, production is only reduced by approximately 70%

  • When both NisB and NisT are expressed (nisABT), dehydrated prenisin is produced efficiently

These findings indicate that while NisB and NisT can function independently, their cooperation significantly improves the production efficiency. This interaction likely involves direct protein-protein contacts that facilitate the handoff of the modified peptide from the modification machinery to the transport system .

What expression systems are available for studying recombinant NisT?

Two main expression systems have been established for studying recombinant NisT:

  • Native L. lactis expression system: This approach utilizes the natural host organism, typically L. lactis NZ9000 or similar strains, with plasmid-based expression of nisin biosynthesis genes. Expression can be controlled using inducible promoters, and the system allows for natural post-translational modifications.

  • Heterologous E. coli expression system: Recombinant nisin production has been established in E. coli by introducing the complete nisin biosynthesis machinery. This system can be particularly useful for genetic manipulation and higher-throughput studies .

For either system, researchers should implement appropriate antibiotic selection markers and optimize expression conditions (temperature, induction time, media composition) to ensure adequate protein production. When expressing NisT alone, it's important to consider that its activity may be substantially reduced without the presence of NisB .

How can site-directed mutagenesis be utilized to study NisT function and structure?

Site-directed mutagenesis represents a powerful approach for investigating specific amino acid residues critical to NisT function. The methodology involves:

  • Identification of target residues: Focus on conserved motifs in ATP-binding cassette transporters, particularly the Walker A and B motifs involved in ATP binding and hydrolysis, and potential substrate-binding domains.

  • Mutagenesis protocol:

    • Design primers containing the desired mutations

    • Perform PCR-based mutagenesis on a plasmid containing the nisT gene

    • Transform into a cloning strain for plasmid amplification

    • Verify mutations by sequencing before transforming into expression hosts

  • Functional analysis: Assess the ability of mutant NisT to transport prenisin by measuring:

    • Nisin/prenisin levels in culture supernatant using HPLC or mass spectrometry

    • Intracellular accumulation of prenisin

    • Antimicrobial activity using indicator strains

  • Structure-function correlation: Map mutations onto structural models of NisT (if available) or homology models based on related ABC transporters to interpret results in a structural context.

This approach has been successfully used to study other components of the nisin biosynthesis machinery and can be adapted for NisT to understand the molecular basis of prenisin recognition and transport .

What experimental designs are most effective for studying NisT-mediated transport kinetics?

To effectively study NisT-mediated transport kinetics, researchers should consider the following experimental design approaches:

  • Pulse-chase experiments:

    • Label prenisin precursors (e.g., with radioactive amino acids)

    • Allow brief expression/labeling period

    • Chase with non-labeled media

    • Sample at defined time points and analyze cellular and extracellular fractions

    • Quantify labeled prenisin to determine transport rates

  • Controlled expression systems:

    • Utilize inducible promoters with tunable expression levels

    • Systematically vary NisT expression levels while measuring transport

    • Determine rate-limiting steps in transport process

  • Real-time monitoring:

    • Develop fluorescently tagged prenisin constructs

    • Monitor transport in real-time using confocal microscopy

    • Correlate with cell growth and viability

  • Factorial experimental design:

    • Apply statistical design of experiments (DOE) methodology

    • Test multiple factors simultaneously (temperature, pH, ATP levels, peptide substrate variations)

    • Identify interaction effects between variables

    • Optimize for maximum transport efficiency

When designing these experiments, resources should be allocated efficiently, with some capacity reserved for center point runs and potential repeated experiments to address processing mishaps, as recommended in experimental design best practices .

How does the absence of NisC affect NisT-mediated transport efficiency?

The absence of NisC (cyclase) has significant but not complete effects on NisT-mediated transport. Kinetic analysis of nisin production demonstrates that:

  • Deletion of nisC reduces prenisin production by approximately 70%

  • The remaining 30% of prenisin production suggests that NisT can transport dehydrated but non-cyclized prenisin

  • This transport occurs less efficiently than for fully modified prenisin (with both dehydration and cyclization)

The experimental approach to study this phenomenon involves:

  • Comparative expression analysis:

    • Express nisABT (without nisC) vs. nisABTC (complete system)

    • Quantify prenisin levels in culture supernatants

    • Analyze by mass spectrometry to confirm modification status

  • Structural analysis of transported peptides:

    • Characterize the dehydrated prenisin lacking thioether rings

    • Compare transport efficiency between different prenisin variants

  • Protein interaction studies:

    • Investigate whether NisC physically interacts with NisT

    • Determine if NisC contributes to the channeling mechanism beyond its cyclization activity

These findings indicate that while NisT preferentially transports fully modified prenisin, it maintains substantial activity for dehydrated prenisin, suggesting flexibility in substrate recognition .

What approaches can be used to incorporate non-canonical amino acids into nisin using the NisT transport system?

Incorporating non-canonical amino acids (ncAAs) into nisin represents an advanced research direction that can generate novel lantibiotics with potentially enhanced properties. Two parallel approaches have been developed:

  • E. coli-based system:

    • Equip E. coli with both the stop codon suppression (SCS) machinery and nisin biosynthesis genes

    • Introduce the pyrrolysyl-tRNA synthetase (PylRS)–tRNAPyl pair for ncAA incorporation

    • Replace specific codons in nisA with amber stop codons

    • Supplement growth media with the chosen ncAA (e.g., Nε-Boc-L-lysine/BocK)

    • Express the complete nisin biosynthesis machinery including NisT

    • Purify modified nisin(BocK) from culture supernatant

  • L. lactis-based system:

    • Expand the genetic code of L. lactis by introducing the PylRS–tRNAPyl pair

    • Create amber codon variants of nisA

    • Express the modification machinery (NisBTC) using appropriate plasmids

    • Supplement growth media with the selected ncAA

    • Analyze transport efficiency and antimicrobial activity

Both approaches result in bioactive nisin variants containing ncAAs. The methodology requires:

  • Construction of amber codon-scanned libraries of nisA

  • Creation of expression vectors containing both ncAA incorporation machinery and nisin biosynthesis genes

  • Optimization of expression conditions

  • Purification and activity testing of modified nisin variants

This approach has successfully produced bioactive nisin(BocK) variants, demonstrating that NisT can transport nisin peptides containing ncAAs .

How can researchers troubleshoot issues with NisT-mediated transport in recombinant systems?

When encountering problems with NisT-mediated transport in recombinant systems, researchers should systematically address potential issues:

  • Expression level verification:

    • Confirm NisT expression using Western blotting

    • Ensure appropriate membrane localization using fractionation techniques

    • Optimize expression conditions (temperature, induction time, media composition)

  • ATP availability:

    • As an ATP-binding cassette transporter, NisT requires ATP for function

    • Ensure sufficient cellular energy status

    • Consider ATP depletion as a potential limiting factor in high-density cultures

  • Co-expression optimization:

    • NisT functions most efficiently when co-expressed with NisB

    • Ensure proper stoichiometry between biosynthesis components

    • Consider using polycistronic constructs to maintain consistent expression ratios

  • Substrate recognition issues:

    • Verify that prenisin is properly synthesized and modified

    • For mutant or engineered nisin variants, consider potential recognition issues

    • Examine intracellular accumulation to determine if transport is the limiting step

  • Statistical analysis approach:

    • Implement a systematic factorial design to identify critical parameters

    • Apply analysis of variance (ANOVA) to determine significant factors

    • Consider interaction effects between multiple variables

When NisT transport appears inefficient, a particularly important consideration is the absence of NisB, as research has shown that the efficiency of prenisin transport by NisT is markedly enhanced by NisB through a channeling mechanism .

What assays can be used to quantify NisT transport efficiency?

Several complementary assays can be employed to quantify NisT transport efficiency:

  • Growth inhibition zone assay:

    • Inoculate solid medium with nisin-sensitive indicator strain (e.g., L. lactis NZ9000)

    • Apply filtered culture supernatant to wells in the agar

    • Measure inhibition zone diameter after incubation

    • Compare with standard curves of known nisin concentrations

    • This approach allows for biological activity quantification

  • Mass spectrometry-based quantification:

    • Collect culture supernatant at defined time points

    • Perform HPLC purification of nisin/prenisin

    • Analyze by mass spectrometry (MALDI-TOF or LC-MS/MS)

    • Quantify using internal standards

    • This method provides precise molecular characterization and quantification

  • Immunological detection:

    • Develop antibodies against the nisin leader peptide or core peptide

    • Perform Western blotting or ELISA of culture supernatants

    • Quantify against standard curves

    • This approach offers high sensitivity and specificity

  • Reporter fusion systems:

    • Create fusions between prenisin and reporter proteins (e.g., fluorescent proteins)

    • Monitor transport by quantifying extracellular fluorescence

    • Normalize against total expression levels

When implementing these assays, researchers should follow established uncertainty evaluation guidelines, including identifying all components of standard uncertainty and providing detailed descriptions of uncertainty evaluation methods .

How can researchers establish appropriate controls for NisT functional studies?

Establishing appropriate controls is critical for reliable interpretation of NisT functional studies:

  • Negative controls:

    • NisT deletion mutant (ΔnisT): Demonstrates the absolute requirement for NisT

    • Inactive NisT mutant: Create point mutations in essential Walker A/B motifs to generate ATPase-inactive NisT

    • Vector-only control: Expression of empty vector to control for plasmid-related effects

  • Positive controls:

    • Wild-type nisin gene cluster: Provides baseline for normal transport efficiency

    • Known functional NisT variants: Includes previously characterized functional variants

  • Specificity controls:

    • Heterologous ABC transporters: Tests whether other transporters can substitute for NisT

    • Non-native substrates: Evaluates substrate specificity of NisT

  • System controls:

    • Expression level monitoring: Ensures comparable protein levels between variants

    • Cell viability assessment: Controls for potential toxicity effects

    • Membrane integrity verification: Rules out non-specific leakage

  • Process controls for experimental design:

    • Center point runs: Helps detect curvature in response surfaces

    • Randomization: Minimizes effects of uncontrolled variables

    • Replication: Assesses experimental variability

These controls should be implemented systematically, and the evaluation of uncertainty should follow established guidelines, with uncertainty components identified according to statistical or other evaluation methods .

What are the optimal conditions for expressing functional recombinant NisT?

The optimal conditions for expressing functional recombinant NisT involve careful consideration of multiple factors:

  • Expression host selection:

    • L. lactis NZ9000: Natural host with appropriate membrane composition and cellular machinery

    • E. coli: Higher yields but potential folding/membrane insertion challenges

    • The choice depends on research objectives and downstream applications

  • Expression vector design:

    • Promoter selection: Inducible promoters (NICE system for L. lactis; T7 for E. coli)

    • Codon optimization: Adapt to host preference if expressing in heterologous system

    • Fusion tags: Consider C-terminal tags to avoid interference with N-terminal signal sequences

  • Co-expression considerations:

    • NisB co-expression: Critical for optimal NisT function via channeling mechanism

    • NisC co-expression: Important for complete modification of prenisin

    • Appropriate stoichiometry: Balance expression levels between components

  • Culture conditions:

    • Temperature: Generally lower temperatures (25-30°C) improve membrane protein folding

    • Induction parameters: Typically, moderate inducer concentrations and mid-log phase induction

    • Media composition: Rich media for L. lactis; defined media supplemented with appropriate carbon sources for E. coli

  • Experimental design approach:

    • Factorial design to test multiple parameters simultaneously

    • Response surface methodology to optimize conditions

    • Statistical analysis to identify significant factors and interactions

Researchers should note that NisT functions optimally when expressed alongside NisB due to their functional coupling. Studies have shown that the efficiency of prenisin transport by NisT is markedly enhanced by NisB, suggesting a channeling mechanism that should be preserved in recombinant expression systems .

How can researchers distinguish between NisT transport limitations and other bottlenecks in nisin production?

Distinguishing between NisT transport limitations and other potential bottlenecks in nisin production requires a systematic analytical approach:

Research has shown that in cells lacking nisT, no secretion was observed, while the expression of nisABC in these cells resulted in considerable growth rate inhibition caused by the intracellular accumulation of active nisin .

What statistical approaches are recommended for analyzing NisT transport efficiency data?

When analyzing NisT transport efficiency data, researchers should employ robust statistical approaches:

  • Descriptive statistics and data visualization:

    • Present transport efficiency as mean ± standard deviation from multiple experiments

    • Create box plots to visualize distribution of transport efficiency data

    • Use scatter plots to identify potential correlations between variables

  • Inferential statistics for hypothesis testing:

    • Apply t-tests for comparing two conditions (e.g., wild-type vs. mutant NisT)

    • Use ANOVA for comparing multiple conditions with post-hoc tests

    • Implement non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) if data violates normality assumptions

  • Advanced statistical models:

    • Multiple regression: Identify relationships between transport efficiency and multiple independent variables

    • Principal component analysis: Reduce dimensionality in complex datasets

    • Hierarchical clustering: Identify patterns in NisT variant behavior

  • Uncertainty evaluation methods:

    • Follow established guidelines for evaluating and expressing uncertainty

    • Identify all components of standard uncertainty

    • Consider both Type A (statistical methods) and Type B (other means) evaluation methods

    • Report results with appropriate coverage factors and confidence intervals

  • Experimental design considerations:

    • Implement factorial designs to efficiently test multiple factors

    • Include center points to detect curvature in response surfaces

    • Allocate resources to allow for potential redos of runs with processing mishaps

When analyzing transport efficiency data, researchers should ensure thorough documentation of the statistical methods employed and provide detailed descriptions of uncertainty evaluation processes .

How does the interaction between NisB and NisT affect data interpretation in transport studies?

The functional interaction between NisB and NisT presents important considerations for data interpretation in transport studies:

  • Channeling mechanism effects:

    • Research has demonstrated that NisB markedly enhances NisT-mediated transport efficiency

    • This suggests a channeling mechanism where prenisin is transferred directly from NisB to NisT

    • Data interpretation must account for this interaction, as transport efficiency in the absence of NisB will be significantly reduced

  • Experimental design implications:

    • When studying NisT mutations or variants, co-expression with NisB is essential

    • Comparative studies should maintain consistent NisB:NisT ratios

    • Changes in NisB expression can confound interpretation of NisT function

  • Quantitative analysis approach:

    • In deletion studies, prenisin production was reduced by 70% in the absence of NisC

    • In contrast, production was nearly completely abolished in the absence of NisB

    • This quantitative difference highlights the greater dependence of NisT function on NisB than on NisC

  • Structural biology considerations:

    • Data may reflect direct protein-protein interactions rather than isolated transport function

    • Interpretation should consider the multi-component nature of the system

    • Models should incorporate the concept of a biosynthetic complex rather than independent proteins

  • Statistical analysis framework:

    • Apply multivariate analysis to distinguish between NisB-dependent and independent effects

    • Consider interaction terms in regression models

    • Implement appropriate experimental designs to test interaction hypotheses

Researchers should note that while NisB and NisT activities are independent of complex formation per se, the efficiency of prenisin production is significantly enhanced when both proteins are present, suggesting sophisticated coordination between the biosynthetic and transport machinery .

What are promising approaches for engineering NisT to transport non-native peptides?

Engineering NisT to transport non-native peptides represents an exciting frontier with several promising approaches:

  • Leader peptide engineering:

    • The nisin leader peptide appears critical for NisT recognition

    • Creating fusion constructs with the nisin leader peptide attached to non-native peptides

    • Systematic mutation of leader peptide residues to identify minimal recognition elements

    • Design of synthetic leader peptides with enhanced NisT affinity

  • Structure-guided engineering:

    • Develop structural models of NisT based on related ABC transporters

    • Identify substrate-binding domains through computational approaches

    • Rationally design mutations to alter substrate specificity

    • Apply molecular dynamics simulations to predict transport efficiency

  • Directed evolution strategies:

    • Create libraries of NisT variants through random mutagenesis

    • Develop high-throughput screening methods for transport of reporter-tagged peptides

    • Implement iterative selection cycles to evolve enhanced variants

    • Combine beneficial mutations for additive or synergistic effects

  • Hybrid transporter engineering:

    • Create chimeric transporters combining domains from NisT and other ABC transporters

    • Exchange substrate-binding domains to alter specificity

    • Optimize linker regions between domains for proper folding and function

Evidence supporting the feasibility of these approaches comes from research demonstrating that NisT can transport a broad variety of modified peptides, including prenisin mutants with mutations in the first two ring structures and medically relevant peptides fused to the nisin leader peptide . Additionally, studies have shown successful incorporation of non-canonical amino acids into nisin, which was then transported by NisT, indicating flexibility in substrate recognition .

How might system-level approaches enhance our understanding of NisT function in the nisin biosynthesis pathway?

System-level approaches offer powerful frameworks for understanding NisT within the broader context of nisin biosynthesis:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Identify regulatory networks controlling nisT expression

    • Map protein-protein interactions within the nisin biosynthesis complex

    • Correlate transport efficiency with global cellular state

  • Mathematical modeling approaches:

    • Develop kinetic models of the complete nisin biosynthesis pathway

    • Incorporate the channeling mechanism between NisB and NisT

    • Simulate the effects of perturbations on system behavior

    • Identify rate-limiting steps and potential optimization targets

  • Synthetic biology frameworks:

    • Reconstitute minimal systems with defined components

    • Systematically vary stoichiometry between components

    • Design orthogonal biosynthetic pathways to study transport in isolation

    • Implement modular design principles for optimized production

  • Cellular localization studies:

    • Investigate subcellular localization of nisin biosynthesis components

    • Determine whether components form discrete complexes or "biosynthetic factories"

    • Examine membrane microdomain involvement in transport efficiency

    • Apply super-resolution imaging to visualize dynamic interactions

  • Experimental design considerations:

    • Implement factorial designs to efficiently test multiple system components

    • Apply response surface methodology to optimize the entire system

    • Develop appropriate statistical models to capture system complexity

Research has shown significant functional coupling between system components, particularly the enhancement of NisT-mediated transport efficiency by NisB, suggesting a channeling mechanism . This observation highlights the importance of studying NisT not in isolation but as part of an integrated biosynthetic system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.