Recombinant Lactococcus lactis subsp. lactis Oligopeptide transport system permease protein oppB (oppB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Characteristics

Recombinant OppB is produced for biochemical studies and protein engineering. Key features include:

PropertyDetailsSource
Expression HostE. coli (commonly used for high-yield production)
TagsN-terminal His-tag (e.g., P0AFH3 variant)
Sequence Length1–319 amino acids (MW ~35 kDa)
Storage BufferTris-based buffer with 50% glycerol, -20°C storage
PurityHigh-purity recombinant protein (suitable for functional assays)

The recombinant protein retains structural integrity, as evidenced by its inclusion in functional studies of the Opp system .

Role in Peptide Transport

OppB’s permease activity is essential for:

  • Substrate Specificity: Transport of hydrophobic and basic peptides; low affinity for acidic residues .

  • Length Tolerance: Accommodates peptides up to 35 residues, with optimal binding for nonamers .

  • Energy Dependence: ATP hydrolysis by OppD and OppF drives peptide translocation .

Genetic and Biochemical Studies

  • Genome Context: In L. lactis subsp. cremoris MG1363, oppB is chromosomally encoded but may be inactivated in some strains .

  • Mutation Studies: Mutations in OppA (e.g., D471R) alter binding kinetics but minimally affect OppB-mediated transport, suggesting OppB’s role in channel formation is conserved .

Challenges in Membrane Protein Production

While L. lactis is a robust host for prokaryotic membrane proteins, challenges arise with complex systems like Opp:

  • Low Expression: OppB’s production in L. lactis is often limited due to the strain’s stress responses (e.g., CesSR two-component system) .

  • Reconstitution Hurdles: Functional reconstitution of the full Opp complex (OppA, OppBC, OppDF) in liposomes remains technically demanding .

Biotechnological Applications

Recombinant OppB is utilized in:

ApplicationDetailsSource
Structural BiologyCrystallography studies to map peptide-binding interactions
Drug TargetingDeveloping inhibitors for antimicrobial strategies
Industrial BiotechnologyOptimizing peptide uptake in starter cultures for dairy fermentation

Comparative Analysis of Recombinant OppB Sources

SupplierKey FeaturesSource
MyBioSourceRecombinant OppB (MBS7024584), optimized for binding assays
Creative BiomartHis-tagged OppB (P0AFH3), expressed in E. coli, 1–306 aa
CBM15ELISA-grade OppB (50 µg), Tris buffer, -20°C storage

Amino Acid Sequence Highlights

The recombinant OppB protein (P0A4N7) includes:

  • Transmembrane Domains: Hydrophobic regions (e.g., residues 1–319) critical for membrane integration .

  • Conserved Motifs: Similarity to other ABC permeases, with residues involved in ATPase coupling .

Research Gaps and Future Directions

  • Mechanistic Studies: Limited data on OppB’s conformational dynamics during peptide translocation.

  • High-Throughput Screening: Potential for engineered OppB variants with enhanced substrate specificity.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which customers can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
oppB; LL1839; L91252; Oligopeptide transport system permease protein OppB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Target Names
oppB
Target Protein Sequence
MWKVIIRRILLMIPQLFILSILVFFFAKLMPGDPFSGLIGPHTDPHEVEALRRAAGLYDP WWEQYLRWLGNAIHGNLGMSYNLKEPVMTVIGHRAINTFWMSLLSVILTYLFAIPMSIVA ARNEGKWQDQLWLTYNSITFGIPPYVFYLLIIFIFGYSLNWFPTGGTVSPDAMGIIPVFF SKIYHMILPAFSLAVFGTVGIFTYFRSGILDEQTQDYVRTARAKGVKEKVIFRRHILRNA SLPIASNFGFVITGLLGGAIFAETIFGYPGLGQLFITSISGRDYSMITALILLNGFLGLL GALLSDIIMAMVDPRIRIQ
Uniprot No.

Target Background

Function
This protein is part of the binding-protein-dependent transport system for oligopeptides. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: lla:L91252

STRING: 272623.L91252

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the oligopeptide transport system in Lactococcus lactis and what role does oppB play?

The oligopeptide transport system in Lactococcus lactis consists of a multicomponent ATP-binding cassette (ABC) transporter encoded by the opp operon, which includes five genes: oppA, oppB, oppC, oppD, and oppF. The OppB protein specifically functions as one of the membrane-spanning permease components of this transport system. This system is crucial for L. lactis to import oligopeptides from the extracellular environment, which are then used as nitrogen and carbon sources after intracellular hydrolysis by peptidases. The transporter is particularly important in dairy environments where milk proteins are degraded into peptides that require specific transport mechanisms for cellular utilization .

How is oppB gene expression regulated in Lactococcus lactis?

The expression of the oppB gene in L. lactis is dynamically regulated according to environmental conditions and growth phase. Transcriptomic analyses have shown that oppB, along with other oligopeptide transport genes (oppA, oppC, oppD, and oppF), exhibits decreased expression after the exponential growth phase in dairy matrices. This downregulation occurs particularly after 24 hours of growth when extracellular proteolysis by enzymes like PrtP increases. The temporal regulation suggests that L. lactis adjusts its oligopeptide transport capacity based on peptide availability and cell density, with high expression during early growth phases followed by significant reduction as alternative nitrogen metabolism pathways engage .

What expression systems are commonly used for recombinant production of L. lactis membrane proteins like oppB?

For recombinant expression of L. lactis membrane proteins including oppB, the nisin-inducible gene expression system (NICE) is frequently employed. This system utilizes the pNZ8048 plasmid or its derivatives, where gene expression is controlled by the nisA promoter. The system is induced by adding nisin A (typically at concentrations around 10 ng/mL) to cultures in the mid-exponential phase of growth. This approach allows tight control of expression timing, with detectable protein production occurring approximately 4-8 minutes after induction and gradually increasing over 64-120 minutes. The NICE system is particularly valuable for membrane protein production as it permits controlled expression levels, which is crucial for proper membrane insertion and folding .

What are the optimal growth conditions for maximizing recombinant oppB expression in L. lactis?

For optimal recombinant oppB expression in L. lactis, researchers should consider the following conditions:

ParameterOptimal ConditionNotes
Growth mediumM17 supplemented with 0.5% glucoseRich medium supports high cell density
Temperature30°CHigher temperatures may reduce protein folding efficiency
pH6.5-7.0 (controlled)pH-regulated bioreactors are recommended
Induction timingMid-exponential phase (OD₆₀₀ = 0.4-0.5)Earlier induction may compromise cell viability
Nisin concentration10 ng/mLHigher concentrations may cause growth arrest
Post-induction time1-2 hoursLonger times may lead to protein degradation
AerationLow to moderateL. lactis is microaerophilic

Growth in pH-controlled bioreactors is recommended for consistent protein production, as this allows precise monitoring of growth parameters and maintenance of optimal physiological conditions. The addition of chloramphenicol (100 μg/mL) immediately after harvesting cells can prevent further protein synthesis or degradation during processing .

What are the challenges in purifying recombinant oppB protein and how can they be addressed?

Purification of recombinant oppB protein presents several challenges due to its nature as an integral membrane protein:

  • Membrane extraction: OppB must be efficiently extracted from the cell membrane while maintaining its native conformation. This can be achieved using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration.

  • Protein stability: OppB tends to aggregate during purification processes. This can be mitigated by:

    • Maintaining low temperatures (4°C) throughout the purification

    • Including glycerol (10-20%) in all buffers

    • Adding specific lipids that stabilize the protein structure

  • Purification efficiency: For affinity chromatography, engineering a C-terminal hexa-histidine tag facilitates purification while minimizing interference with protein function. Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with imidazole gradients (20-250 mM) can effectively separate the tagged protein.

  • Functional assessment: Verifying that the purified protein retains functionality is crucial. This can be done through reconstitution into proteoliposomes and measuring peptide transport activity using radiolabeled or fluorescently labeled peptide substrates .

How can researchers verify successful membrane integration of recombinant oppB?

Verification of successful membrane integration of recombinant oppB can be accomplished through multiple complementary approaches:

  • Western blotting with cellular fractionation: Separating membrane fractions from cytosolic components and analyzing by SDS-PAGE followed by immunoblotting with anti-His tag antibodies (if the protein is His-tagged) confirms the presence of oppB in the membrane fraction.

  • Protease accessibility assays: In properly oriented membrane vesicles, portions of oppB should be accessible to externally added proteases, while other domains are protected. Limited proteolysis followed by fragment analysis can confirm correct membrane topology.

  • Fluorescence microscopy: Fusion of oppB with fluorescent proteins like GFP can visualize membrane localization, though care must be taken that the fusion doesn't interfere with membrane insertion.

  • Functional assays: Measuring oligopeptide transport activity in cells or membrane vesicles provides the most definitive evidence of proper membrane integration and functional assembly of the complete Opp transport system .

How can recombinant L. lactis oppB be engineered for enhanced oligopeptide transport capacity?

Engineering L. lactis oppB for enhanced oligopeptide transport involves several sophisticated approaches:

  • Rational mutagenesis based on structure-function relationships: Targeted modification of amino acids in the substrate binding pocket or transmembrane domains can alter substrate specificity or increase transport rates. This approach requires detailed knowledge of oppB structure, which can be predicted through homology modeling based on related ABC transporters.

  • Directed evolution: Creating libraries of oppB variants through random mutagenesis (error-prone PCR) or DNA shuffling, followed by selection for enhanced transport phenotypes using growth-based selection schemes with limiting oligopeptide concentrations.

  • Promoter engineering: Replacing the native oppB promoter with constitutive or alternative inducible promoters that provide higher expression levels, while carefully balancing expression with membrane insertion capacity.

  • Co-expression optimization: Adjusting the stoichiometry of the entire Opp system (OppA, OppB, OppC, OppD, OppF) to ensure balanced production of all components, possibly by creating synthetic operons with optimized translation efficiency for each component .

Each approach requires careful validation of protein expression, membrane integration, and transport activity to ensure that engineering efforts result in functional improvements rather than simply increased protein production.

What are the implications of oppB expression dynamics for L. lactis adaptation in different environments?

The dynamic regulation of oppB expression reflects sophisticated adaptation mechanisms in L. lactis:

  • Nutrient availability response: The downregulation of oppB after 24 hours of growth correlates with increased extracellular proteolysis (via PrtP), suggesting that L. lactis actively modulates its peptide import machinery based on environmental peptide availability.

  • Energy conservation strategy: The ATP-dependent Opp system represents a significant energy investment. The decrease in oppB expression after the exponential phase likely represents an energy conservation strategy when growth rates slow and ATP demand for other cellular processes increases.

  • Ecological niche adaptation: In dairy environments, the temporal expression pattern of oppB and other opp genes enables efficient utilization of milk proteins through a coordinated sequence: initial rapid uptake of available peptides, followed by extracellular proteolysis and selective uptake of newly generated peptides.

  • Stress response integration: Expression of oppB is integrated with broader stress responses, including acid stress adaptation, which is particularly relevant in fermentative environments where pH decreases over time due to lactic acid production .

These dynamic expression patterns highlight the sophisticated regulatory networks that allow L. lactis to optimize resource allocation and maintain fitness across changing environmental conditions.

How can transcriptomic and proteomic approaches be integrated to study oppB regulation and function?

Integrated omics approaches provide powerful insights into oppB regulation and function:

  • Time-resolved transcriptomics: Using DNA microarrays or RNA-seq to track oppB expression changes over time, particularly during environmental transitions. This approach revealed that oppB transcript levels decrease substantially after 24 hours of growth in cheese models, correlating with shifts in nitrogen metabolism .

  • Quantitative proteomics: Using methodologies such as iTRAQ-labeling coupled with strong cation exchange (SCX) chromatography and LC-MS/MS to quantify OppB protein levels. This allows researchers to determine if protein abundance correlates with transcript levels or if post-transcriptional regulation occurs .

  • Integration strategies:

    • Temporal correlation analysis between transcript and protein abundance

    • Pathway enrichment analysis to identify coordinated regulation of oppB with functionally related genes

    • Network analysis to map regulatory connections between oppB and global cellular processes

  • Validation methods:

    • Targeted RT-qPCR for specific transcript quantification

    • Western blotting for protein level confirmation

    • Reporter gene constructs (e.g., oppB promoter fused to fluorescent proteins) to visualize regulation in real-time

The integration of multiple omics layers provides a systems-level understanding of how oppB contributes to L. lactis adaptation and function, revealing regulatory mechanisms that cannot be discerned from single-omics approaches .

What methods are most effective for studying the substrate specificity of recombinant oppB in L. lactis?

Several complementary approaches can effectively characterize oppB substrate specificity:

  • Competition assays: Using a known transported peptide (radiolabeled or fluorescently labeled) and measuring transport inhibition in the presence of unlabeled potential substrates. This approach allows screening of multiple peptides to determine relative binding affinities.

  • Direct transport measurements: Quantifying the uptake of various labeled peptides in cells or membrane vesicles expressing recombinant oppB. Time-course measurements can provide kinetic parameters (Km, Vmax) for different substrates.

  • Growth phenotype analysis: Constructing oppB deletion strains and complementing with recombinant oppB variants, then assessing growth in minimal media with specific oligopeptides as the sole nitrogen source. This links transport to physiological outcomes.

  • Structural biology approaches: Combining homology modeling with site-directed mutagenesis to identify key residues in the substrate-binding pocket. Each mutant can be characterized functionally to map the molecular determinants of substrate specificity .

These methods collectively provide a comprehensive profile of oppB substrate preferences, which is essential for understanding its physiological role and potential biotechnological applications.

How does oppB interact with other components of the oligopeptide transport system?

OppB functions as part of a multicomponent oligopeptide transport system, with specific interaction patterns:

  • Interaction with OppC: OppB and OppC together form the transmembrane domain (TMD) of the transporter, creating a channel through which oligopeptides pass. These proteins interact extensively through their transmembrane helices, forming a heterodimeric complex that defines the substrate translocation pathway.

  • Interaction with OppD/OppF: The nucleotide-binding domains (NBDs) OppD and OppF interact with cytoplasmic loops of OppB to couple ATP hydrolysis to conformational changes that drive transport. These interactions typically involve conserved coupling helices in OppB that transmit the energy of ATP hydrolysis to changes in transmembrane helix packing.

  • Interaction with OppA: The substrate-binding protein OppA delivers oligopeptides to the transmembrane domains. OppA interacts with extracellular loops of OppB during the substrate delivery process, with conformational changes in OppA triggering subsequent changes in OppB that initiate the transport cycle.

  • Functional interplay: The expression levels of these components are typically coordinated, as seen in transcriptomic data showing similar expression patterns for oppA, oppB, oppC, oppD, and oppF genes during growth in dairy environments .

Understanding these interactions is crucial for engineering the system for biotechnological applications or for designing inhibitors that might disrupt oligopeptide transport.

What is the impact of different growth conditions on oppB expression and function?

The expression and function of oppB in L. lactis show significant variability across growth conditions:

ConditionImpact on oppB ExpressionFunctional Consequences
Growth phaseHigh in early exponential phase, decreases after 24hCorrelates with changing nitrogen utilization strategies
Nitrogen availabilityRepressed by excess free amino acidsResource allocation when peptide transport is unnecessary
Carbon sourceDifferent expression in glucose vs. galactose mediaReflects metabolic shifts affecting nitrogen requirements
pHAcid stress affects expression patternsMay link to adaptation in fermentative environments
Oxygen levelsMicroaerobic conditions preferred for expressionReflects natural niche adaptation of L. lactis
Media complexityDifferent regulation in defined vs. complex mediaResponse to peptide availability varies with medium

Transcriptomic analyses have revealed that oppB expression is tightly regulated depending on environmental conditions. In cheese models, oppB expression decreases substantially after 24 hours, coinciding with changes in proteolysis and peptide availability. This dynamic regulation ensures that L. lactis invests in oligopeptide transport only when beneficial for growth and survival .

How can recombinant L. lactis expressing modified oppB be used for targeted delivery of bioactive peptides?

Recombinant L. lactis expressing modified oppB can serve as an effective vehicle for targeted delivery of bioactive peptides:

  • Engineering approach: The substrate specificity of oppB can be modified through directed mutagenesis to preferentially transport peptides with specific therapeutic activities. This could involve:

    • Altering the substrate-binding pocket dimensions

    • Modifying charged residues to change affinity for differently charged peptides

    • Engineering the channel diameter to accommodate peptides of specific sizes

  • Delivery system design: The genetically modified L. lactis could be engineered to:

    • Express modified oppB with altered specificity

    • Co-express therapeutic peptides that can be transported via the modified system

    • Include environmentally-responsive promoters that activate the system at specific sites in the host

  • Applications in inflammatory conditions: Similar to how L. lactis has been used to deliver anti-inflammatory molecules like p62, modified oppB systems could facilitate transport of immunomodulatory peptides for treating inflammatory bowel diseases. The intrinsic immunomodulatory properties of L. lactis NCDO2118 could be enhanced through strategic peptide delivery .

  • Validation methods: Efficacy of such systems would require demonstration of:

    • Modified transport specificity in vitro

    • Peptide delivery in relevant animal models

    • Therapeutic outcomes in disease models such as DSS-induced colitis

This approach combines the natural probiotic properties of L. lactis with engineered peptide transport to create novel therapeutic delivery systems.

What are the key considerations for designing expression vectors for oppB studies in different research contexts?

Designing expression vectors for oppB studies requires careful consideration of several factors:

  • Promoter selection:

    • Inducible promoters (like the nisin-inducible nisA promoter) allow precise control of expression timing and level, critical for toxic membrane proteins

    • Constitutive promoters may be appropriate for long-term experiments requiring stable expression

    • Native oppB promoter for studying natural regulation patterns

  • Tag placement and type:

    • C-terminal tags are generally preferred for membrane proteins to minimize interference with membrane targeting signals

    • His6 tags facilitate purification but may affect function

    • Fluorescent protein fusions enable visualization but may impair membrane insertion

    • Cleavable tags offer flexibility for post-purification tag removal

  • Vector backbone considerations:

    • Copy number appropriate for the experimental goals (low copy for physiological studies, higher copy for overexpression)

    • Selection markers compatible with L. lactis (typically chloramphenicol or erythromycin resistance)

    • Origin of replication stable in lactic acid bacteria

  • Additional elements:

    • Ribosome binding site optimization for L. lactis codon usage

    • Terminator sequences to prevent read-through transcription

    • Signal sequences if altered localization is desired

These design elements should be tailored to specific research questions, with simpler constructs for basic characterization and more complex designs for advanced functional studies.

What strategies can resolve low expression yields of recombinant oppB in L. lactis?

Researchers encountering low expression yields of recombinant oppB can implement several targeted strategies:

  • Optimization of induction parameters:

    • Fine-tune nisin concentration (5-20 ng/mL range)

    • Adjust induction timing (OD600 0.3-0.7)

    • Optimize post-induction temperature (25-30°C)

    • Extend or shorten expression time (1-4 hours)

  • Genetic construct modifications:

    • Codon optimization for L. lactis preferred codons

    • Use of stronger ribosome binding sites

    • Evaluation of alternative signal sequences

    • Testing different fusion tags that may enhance stability

  • Growth media adjustments:

    • Supplementation with additional glucose (0.5-1%)

    • Addition of compatible solutes (betaine, proline)

    • Osmotic stabilization with sorbitol or sucrose

    • Inclusion of membrane-stabilizing components (lipids)

  • Host strain considerations:

    • Use of protease-deficient strains

    • Selection of strains with enhanced membrane protein expression capacity

    • Consideration of different L. lactis subspecies (lactis vs. cremoris)

  • Process adjustments:

    • Implementation of fed-batch cultivation

    • Control of pH to optimize folding and stability

    • Protection from shear stress in bioreactors

    • Gentle harvesting and cell disruption methods

Systematic testing of these strategies, ideally using a design of experiments (DoE) approach, can identify optimal conditions for each specific recombinant oppB construct.

How can researchers distinguish between native and recombinant oppB in functional studies?

Distinguishing between native and recombinant oppB in functional studies requires careful experimental design:

  • Genetic approaches:

    • Creation of oppB deletion strains (ΔoppB) as expression hosts eliminates native background

    • Introduction of silent mutations in recombinant oppB creates restriction sites for PCR validation

    • Use of subspecies-specific sequence variations when working across L. lactis subspecies

  • Protein-level differentiation:

    • Addition of epitope tags (His, FLAG, c-Myc) to recombinant oppB allows specific immunodetection

    • Size differences through fusion partners or truncated variants

    • Use of antibodies raised against specific regions that differ between native and recombinant proteins

  • Functional discrimination:

    • Introduction of point mutations that alter substrate specificity

    • Creation of chimeric proteins with parts from other transporters

    • Development of specific inhibitors that selectively target native or recombinant variants

  • Expression control approaches:

    • Use of tightly regulated inducible promoters allows temporal control of recombinant expression

    • Quantitative calibration of expression levels relative to native background

    • Complementation studies in oppB knockout strains

These strategies provide multiple layers of discrimination, allowing researchers to confidently attribute observed transport activities to either native or recombinant oppB proteins.

What are the critical quality control checkpoints for recombinant oppB research?

Establishing rigorous quality control checkpoints ensures reliable and reproducible recombinant oppB research:

  • Genetic construct verification:

    • Complete DNA sequencing of expression constructs

    • Restriction enzyme analysis to confirm vector integrity

    • PCR verification of correct insert orientation and size

    • Confirmation of maintenance in L. lactis without sequence alterations

  • Expression validation:

    • Quantitative assessment of mRNA levels by RT-qPCR

    • Protein detection via Western blotting with appropriate controls

    • Subcellular localization confirmation through fractionation

    • Assessment of protein homogeneity by size-exclusion chromatography

  • Functional characterization:

    • Transport activity measurements using multiple substrates

    • Determination of kinetic parameters (Km, Vmax)

    • Comparison with wild-type activity levels

    • Specificity testing against related and non-related peptides

  • Structural integrity assessment:

    • Circular dichroism to verify secondary structure

    • Limited proteolysis to confirm proper folding

    • Thermal stability analysis

    • Oligomeric state determination

  • Reproducibility measures:

    • Growth curve standardization

    • Batch-to-batch consistency checks

    • Biological and technical replication

    • Statistical validation of significant differences

Implementing these checkpoints throughout the research workflow significantly enhances data reliability and facilitates troubleshooting when experimental outcomes deviate from expectations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.