Recombinant Lactococcus lactis subsp. lactis Oligopeptide transport system permease protein oppC (oppC)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
oppC; LL1838; L90358; Oligopeptide transport system permease protein OppC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-294
Protein Length
full length protein
Species
Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Target Names
oppC
Target Protein Sequence
MTEKKHKNSLSLVHSIKEELKKDKLAMISTIFLVAVFLIVYIYSMFLKQSNYVDVNIMDQ
YLAPLTNGHLLGTDNGGRDIIMMLMISARNSFNIAFAVTLITLVVGNILGVITGYFGGRF
DLIFMRFTDFVMILPSMMIIIVFVTIIPRFNSWSLIGIISIFSWIGTTRLIRARTMTEVN
RDYVRASKTSGTSDFKIMFREIWPNLSTLVIAEATLVFAGNIGLETGLSFLGFGLPAGTP
SLGTMINEATNPETMTDKPWTWVPATVVILIVVLAIIFIGNALRRVADQRQATR
Uniprot No.
Target Background
Function
This protein is a component of the binding-protein-dependent oligopeptide transport system. Its primary function is likely the translocation of oligopeptide substrates across the membrane.
Database Links
KEGG: lla:L90358
STRING: 272623.L90358
Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
