Recombinant Lactococcus lactis subsp.lactis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Role

Lgt is a membrane-bound enzyme that catalyzes the lipidation of prolipoproteins, a critical step in the maturation of bacterial lipoproteins. In L. lactis, this enzyme transfers a diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue in the "lipobox" motif (LVIASTVIGASC(+1)) of prolipoproteins . Recombinant Lgt proteins are often His-tagged for purification and expressed in E. coli due to scalability .

Key Features of Recombinant Lgt

ParameterValue/DescriptionSource
Expression HostE. coli
TagN-terminal or C-terminal 6xHis-tag
Molecular Weight~32.6 kDa
Purity>85% (SDS-PAGE)
Storage-20°C/-80°C (liquid/lyophilized)
UniProt IDQ9CHU9

Comparative Biochemical Data

ParameterL. lactis LgtE. coli LgtSource
Specific Activity~20-fold lower than E. coliReference standard
K<sub>m</sub> (PG)Similar to E. coli (~0.2 mM)~0.2 mM
Active-Site ResidueTyr-103 (vs. His-103 in E. coli)His-103

The His→Tyr substitution in L. lactis Lgt suggests evolutionary divergence in gram-positive bacteria, with implications for catalytic efficiency .

Lipoprotein Maturation

  • NisI Anchoring: Lgt is essential for membrane anchoring of NisI, a lipoprotein conferring nisin resistance in L. lactis F44 .

  • Signal Peptide Cleavage: While Lsp (lipoprotein signal peptidase II) cleaves the signal peptide, Lgt ensures proper lipidation for membrane retention .

Vaccine Development

Recombinant L. lactis strains expressing Lgt-modified antigens (e.g., HSV-1 glycoprotein D) enhance mucosal and systemic immunity. For example:

  • gD-IL-2-Fc Fusion: Boosts IgA/IgG titers and T-cell proliferation in mice .

  • Mechanism: Fc fragments (via FcRn) improve antigen delivery across mucosal barriers .

Expression Systems

SystemDetailsYieldSource
P170 PromoterInducible, lactate-responsive; used for recombinant protein secretion.Up to 2.5 g/L
REED™ TechnologyElectro-dialysis to control lactate levels during fermentation.Enhanced yields

Industrial Relevance

  • Nisin Production: Optimizing Lgt activity in L. lactis F44 improves nisin resistance, enabling higher antibiotic yields .

  • Protease-Free Strains: L. lactis is preferred for protein production due to minimal endogenous proteases .

Limitations and Challenges

  • Low Specific Activity: L. lactis Lgt exhibits ~20-fold lower activity than E. coli Lgt, requiring larger quantities for in vitro assays .

  • Endotoxin-Free Production: L. lactis avoids endotoxin contamination, making it suitable for medical applications .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based solution containing 5%-50% glycerol.
Please note: If you have specific requirements regarding the glycerol content, kindly indicate them in your order notes.
For lyophilized powder delivery forms, the buffer used before lyophilization is a Tris/PBS-based solution containing 6% Trehalose.

Form
Available in Liquid or Lyophilized powder format.
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please contact your local distributors.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 6xHis-tagged
Synonyms
lgt; LL0619; L5776; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Datasheet & Coa
Please contact us to get it.
Expression Region
1-261aa
Mol. Weight
32.6 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Others
Source
in vitro E.coli expression system
Species
Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Target Names
lgt
Target Protein Sequence
MNNLFPFLALNKIALQLGPLAIHWYAIFIVGGAALAVWLACKEAPKRNIKTDDIIDFVLFAFPLGIVGARLYYVIFQWSYYSQHPSQIIAMWDGGGAIYGSLIAGAIVLFVFSYYRMIHPLDLLDITIPGVFLAQAMGRWGNFVNQEAYGKIVSNLDWLPAFIRNQMFIDGHYRMPTFLFESIGTLSGFILVMVFRHRIKGLKRGDIFSFYLVWYGAVRFIVEGMRTDSLMLGPARVSQWLSVLLVIVGLVLFIYRRMKKN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: lla:L5776

STRING: 272623.L5776

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (Lgt) and what is its role in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification of bacterial lipoproteins. Specifically, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine residue in the lipobox motif of prolipoproteins. This modification is essential for proper localization and function of bacterial lipoproteins, which play critical roles in cell envelope architecture, nutrient uptake, transport, adhesion, and virulence . The Lgt-catalyzed reaction is the initial and crucial step in lipoprotein biogenesis, and its deletion is lethal to most gram-negative bacteria, highlighting its fundamental importance in bacterial physiology .

How does Lactococcus lactis Lgt differ from Escherichia coli Lgt?

Comparative studies between L. lactis and E. coli Lgt have revealed both similarities and significant differences:

  • Kinetic properties: L. lactis Lgt exhibits similar Km and Vmax values compared to E. coli Lgt, indicating comparable substrate affinity despite structural differences .

  • Specific activity: The specific activity of purified L. lactis Lgt is approximately 20 times lower than that of the E. coli enzyme, suggesting differences in catalytic efficiency or protein folding .

  • Key amino acid substitution: Bioinformatic analysis has identified that the conserved and catalytically important His-103 residue in E. coli Lgt is altered to Tyr in L. lactis Lgt. This substitution appears to be evolutionarily significant and is shared with certain other gram-positive bacteria .

  • Evolutionary divergence: The His-to-Tyr alteration marks a divergence point within gram-positive bacteria during evolution, with Mycobacterium smegmatis also exhibiting this substitution .

These differences may reflect adaptations to the distinct cell envelope architecture and lipoprotein requirements of gram-positive bacteria like L. lactis compared to gram-negative bacteria such as E. coli.

Why is Lactococcus lactis particularly valuable as a research model for Lgt studies?

Lactococcus lactis offers several advantages as a research model for studying Lgt and bacterial lipoprotein modification:

  • Safety profile: L. lactis is a non-pathogenic gram-positive bacterium with a long history of safe use in food production, making it amenable to laboratory work without specialized containment requirements .

  • Lack of endotoxins: Unlike gram-negative bacteria, L. lactis does not produce endotoxins, which simplifies protein purification and reduces concerns about contamination in downstream applications .

  • Genetic tractability: L. lactis is genetically amenable, allowing for relatively straightforward genetic manipulation, which is essential for studying enzyme function through mutation analysis .

  • Minimal proteolytic activity: Current non-dairy L. lactis production strains contain few proteases, which enhances the stability of recombinant proteins and facilitates their secretion to the growth medium .

  • Distinct gram-positive cell envelope: As a gram-positive bacterium, L. lactis provides insights into lipoprotein modification in a cellular context different from the more extensively studied gram-negative systems, contributing to a more comprehensive understanding of bacterial lipoprotein biosynthesis .

What are the optimal expression systems for producing recombinant Lgt in Lactococcus lactis?

Several expression systems have been optimized for recombinant protein production in L. lactis, with the P170 expression system being particularly effective for Lgt production:

  • P170 expression system: This system utilizes an inducible promoter (P170) that is up-regulated as lactate accumulates in the growth medium. Key optimizations include:

    • Improved promoter strength for enhanced expression levels

    • Optimized signal peptides for efficient protein secretion

    • Selection of production strains with increased productivity

  • pMG36e vector system: This expression vector has been successfully used for recombinant protein expression in L. lactis, including the construction of fusion proteins with enhanced Green Fluorescent Protein (eGFP) .

  • Electroporation parameters for transformation:

    • Pulse: 25 μf

    • Voltage: 2200 V

    • Resistance: 200 Ω

For Lgt specifically, cationic-exchange chromatography has proven effective for purification, yielding a 20-fold increase in specific activity compared to the load, with recovery of 75% of the total Lgt activity loaded .

How can researchers overcome the growth limitations caused by lactate accumulation during recombinant protein production in L. lactis?

Lactate accumulation during fermentation inhibits growth and limits yield in batch and fed-batch processes. Researchers can address this limitation through several strategies:

  • REED™ technology integration: Combining the P170 expression system with REED™ (Reversible Electro-Enhancement Dialysis) technology allows control of lactate concentration by electro-dialysis during fermentation. This approach has achieved production yields of up to 2.5 g/L for other recombinant proteins (e.g., Staphylococcus aureus nuclease) .

  • Optimized batch fermentation: A simple batch fermentation process using growth medium without animal-derived components can be effective, though with lower yields than REED™-enhanced processes .

  • Media optimization: Adjusting the buffering capacity of the growth medium can help mitigate the effects of lactate accumulation and extend the productive phase of fermentation.

  • Strain engineering: Developing L. lactis strains with altered lactate metabolism or enhanced acid tolerance can improve growth and protein production under acidic conditions.

Implementing these strategies requires careful optimization of fermentation parameters, including temperature, pH control, and aeration, to maximize recombinant Lgt production while maintaining enzyme activity and stability.

What methods are most effective for detecting and quantifying recombinant Lgt expression in L. lactis?

Multiple complementary techniques are recommended for comprehensive detection and quantification of recombinant Lgt expression:

  • Fluorescence microscopy: When Lgt is expressed as a fusion protein with fluorescent reporters like eGFP, direct visualization of expression can be achieved using fluorescence microscopy, which allows for rapid screening of positive recombinant colonies .

  • Western blotting: This technique can determine whether the recombinant protein exists in the supernatant (secreted) or intracellularly (soluble or insoluble fractions). The protocol involves:

    • Separation of culture supernatant and bacterial pellet by centrifugation (12,000 rpm, 5 min)

    • Protein extraction from cellular fractions

    • SDS-PAGE separation

    • Transfer to membrane and immunodetection using specific antibodies

  • Enzymatic activity assays: Quantification of Lgt activity can be performed by monitoring the transfer of diacylglyceryl from phosphatidylglycerol to a synthetic peptide substrate containing the lipobox motif, followed by detection of the lipidated product.

  • PCR and restriction enzyme analysis: These methods can confirm the presence and integrity of the recombinant lgt gene in transformed L. lactis strains .

  • 16S rRNA sequencing: This approach can be used to confirm the identity of the L. lactis strain carrying the recombinant construct .

For accurate quantification, a combination of these methods is recommended to account for both expressed protein levels and functional enzyme activity.

What structural features are critical for Lgt function based on crystallographic studies?

While the crystal structure of L. lactis Lgt has not been specifically reported in the provided search results, structural insights from E. coli Lgt (resolved at 1.9 Å resolution) reveal critical features likely conserved across bacterial species:

Understanding these structural features provides a foundation for rational mutagenesis studies to further elucidate the catalytic mechanism and substrate specificity of L. lactis Lgt.

How do mutations in key residues affect Lgt activity in L. lactis compared to other bacterial species?

Complementation studies using lgt-knockout cells transformed with different mutant Lgt variants have provided valuable insights into structure-function relationships:

  • Conservation and divergence: The catalytically important His-103 residue in E. coli Lgt is altered to Tyr in L. lactis, representing a significant evolutionary divergence within gram-positive bacteria .

  • Impact on catalytic efficiency: Despite this substitution, L. lactis Lgt maintains similar substrate affinity (comparable Km values) to E. coli Lgt, but exhibits approximately 20-fold lower specific activity .

  • Essential arginine residues: Studies with E. coli Lgt indicate that Arg143 and Arg239 are critical for diacylglyceryl transfer activity. Mutations in these residues abolish enzymatic function .

  • Species-specific adaptations: The His-to-Tyr substitution in L. lactis likely represents an adaptation to the gram-positive cell envelope environment or to specific substrate characteristics in this bacterial group .

The comparative analysis of these mutations across different bacterial species provides insights into the evolutionary adaptability of Lgt while maintaining its essential function in bacterial lipoprotein biosynthesis.

What is known about the catalytic mechanism of Lgt in Lactococcus lactis?

The catalytic mechanism of Lgt in L. lactis can be inferred from studies of the E. coli enzyme, with consideration of the key amino acid differences:

  • Reaction catalyzed: Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the conserved cysteine residue in the lipobox of prolipoproteins .

  • Substrate binding: The enzyme likely binds phosphatidylglycerol and the prolipoprotein substrate simultaneously in distinct binding pockets .

  • Catalytic residues: In E. coli, His-103 is implicated in the catalytic mechanism, potentially serving as a general base to activate the thiol group of the acceptor cysteine. In L. lactis, this function may be fulfilled by Tyr, potentially with altered efficiency .

  • Arginine residues: Arg143 and Arg239 are essential for activity, possibly involved in substrate binding or stabilization of reaction intermediates .

  • Lateral access model: Structural data from E. coli Lgt supports a mechanism where substrates and products enter and exit the enzyme laterally from the membrane bilayer .

The altered catalytic efficiency observed in L. lactis Lgt (20-fold lower specific activity compared to E. coli) likely reflects differences in how the Tyr residue participates in the reaction mechanism compared to His in the E. coli enzyme .

How can recombinant L. lactis expressing Lgt be used for vaccine development?

Recombinant L. lactis strains have significant potential as vaccine delivery vehicles, with several advantageous properties:

  • Mucosal immune stimulation: L. lactis can deliver antigens directly to mucosal surfaces, stimulating both systemic and mucosal immune responses. For example, recombinant L. lactis expressing viral antigens such as DHAV-1/VP1 has shown promise as an oral vaccine .

  • Intestinal colonization: Studies have demonstrated that recombinant L. lactis can colonize various segments of the intestinal tract (duodenum, jejunum, ileum, cecum, colon), facilitating prolonged antigen exposure and immune stimulation .

  • Safe delivery system: L. lactis lacks endotoxins and has a long history of safe use, making it an attractive alternative to attenuated pathogenic bacteria for vaccine delivery .

  • Secretion systems: Using appropriate signal peptides (e.g., Usp45), recombinant antigens can be efficiently secreted by L. lactis, enhancing their presentation to the immune system .

  • Expression system optimization: By combining the P170 expression system with technologies like REED™, high-level antigen expression can be achieved, potentially enhancing vaccine efficacy .

For specific application in vaccine development, researchers typically construct recombinant L. lactis strains using electroporation (conditions: 25 μf pulse, 2200 V voltage, 200 Ω resistance) and verify expression through fluorescence microscopy, Western blotting, and immunological assays .

What role does Lgt play in the development of novel antibiotic targets against pathogenic bacteria?

Lgt represents a promising antibiotic target for several reasons:

  • Essential function: Deletion of the lgt gene is lethal to most gram-negative bacteria, indicating its essential role in bacterial survival .

  • Ubiquitous presence: Lgt is found across diverse bacterial species but absent in eukaryotes, making it an attractive target for broad-spectrum antibiotics with minimal host toxicity .

  • Structural insights: The crystal structure of E. coli Lgt (resolved at 1.9 Å) has revealed specific binding sites that could be targeted by small molecule inhibitors. For example, palmitic acid has been shown to inhibit Lgt activity .

  • Evolutionary divergence: The identification of key differences between gram-positive and gram-negative Lgt enzymes (e.g., the His-to-Tyr substitution in L. lactis) suggests the possibility of developing species-specific inhibitors .

  • Resistance considerations: As a novel target, Lgt-directed antibiotics would potentially face minimal pre-existing resistance mechanisms, although resistance development through mutation of non-essential residues remains a consideration.

Research on L. lactis Lgt contributes to this field by providing comparative data on enzyme structure and function across bacterial species, which can inform the design of inhibitors with optimal specificity and efficacy profiles.

How can Lgt studies in L. lactis inform our understanding of bacterial evolution?

Comparative analysis of Lgt across bacterial species provides valuable insights into bacterial evolution:

  • Gram-positive/gram-negative divergence: The His-to-Tyr substitution in L. lactis Lgt represents a significant evolutionary branch point within gram-positive bacteria .

  • Horizontal gene transfer: Genomic analysis of L. lactis has indicated horizontal transfer of genetic information from Lactococcus to gram-negative enteric bacteria of the Salmonella-Escherichia group, suggesting complex evolutionary relationships .

  • Adaptation to ecological niches: L. lactis has evolved specialized metabolic pathways that enable it to thrive in dairy environments, potentially influencing the function and substrate specificity of enzymes like Lgt .

  • Comparative genomics: The complete genome sequence of L. lactis strain IL1403 (2,365,589 base pairs encoding 2310 proteins) reveals evolutionary insights such as the presence of six prophages and 43 insertion sequence elements, indicating a dynamic genome shaped by horizontal gene transfer and recombination events .

  • Evolutionary conservation of essential pathways: Despite divergence in specific residues, the lipoprotein biosynthesis pathway remains functionally conserved across diverse bacterial species, highlighting its fundamental importance throughout bacterial evolution .

These evolutionary insights contribute to our broader understanding of bacterial phylogeny, adaptation, and the conservation of essential cellular processes across diverse bacterial lineages.

What are the key considerations when designing complementation experiments with lgt-knockout cells?

Complementation studies with lgt-knockout cells require careful experimental design:

  • Conditional knockout strategy: Since lgt deletion is lethal in most gram-negative bacteria, conditional knockout systems may be necessary, using inducible promoters to control lgt expression during the construction of knockout strains .

  • Selection of expression vectors: For complementation studies, vectors should be chosen based on:

    • Compatibility with the host strain

    • Appropriate promoter strength (constitutive vs. inducible)

    • Copy number considerations

    • Inclusion of suitable selection markers

  • Controls:

    • Positive control: Wild-type lgt gene in the same expression vector

    • Negative control: Empty vector without lgt

    • Additional control: Complementation with known inactive lgt mutants (e.g., R143 or R239 mutants)

  • Verification methods:

    • PCR confirmation of knockout and complementation

    • Western blotting to verify protein expression

    • Enzymatic activity assays to confirm functional complementation

    • Growth phenotype analysis under various conditions

  • Phenotypic analysis: Assessment of complementation should include:

    • Growth rate measurements

    • Cell morphology examination

    • Membrane integrity assays

    • Lipoprotein localization studies

For site-directed mutagenesis studies, careful selection of residues based on structural information and evolutionary conservation is essential to generate informative results about the structure-function relationships of Lgt.

How can researchers optimize the purification of recombinant Lgt from L. lactis?

Purification of membrane proteins like Lgt presents significant challenges. Based on the reported successful purification of L. lactis Lgt, the following optimization strategies are recommended:

  • Extraction protocol:

    • Cell disruption method: Sonication or high-pressure homogenization

    • Detergent selection: Critical for solubilizing membrane proteins while maintaining activity

    • Buffer composition: pH, salt concentration, and stabilizing agents need optimization

  • Cationic-exchange chromatography:

    • This method has been shown to yield a 20-fold increase in specific activity of L. lactis Lgt

    • Recovery rates of up to 75% of total loaded activity can be achieved

  • Activity preservation:

    • Addition of phospholipids to stabilize the enzyme during purification

    • Inclusion of glycerol or other osmolytes to prevent aggregation

    • Temperature control during all purification steps

  • Scale-up considerations:

    • Culture conditions: GM17 medium has been used successfully for L. lactis cultivation

    • Induction parameters: For the P170 system, lactate accumulation triggers expression

    • Harvest timing: Critical for optimal yield and activity

  • Quality control:

    • SDS-PAGE and Western blotting to assess purity and integrity

    • Activity assays to confirm functionality of the purified enzyme

    • Mass spectrometry to verify identity and detect any modifications

The relatively low abundance of Lgt in bacterial membranes makes purification challenging, but optimizing these parameters can yield sufficient quantities for biochemical and structural studies .

What are the most common technical challenges in expressing and characterizing recombinant Lgt, and how can they be addressed?

Researchers face several technical challenges when working with recombinant Lgt:

  • Low expression levels:

    • Solution: Optimize codon usage for the host organism

    • Solution: Use stronger promoters or inducible expression systems like P170

    • Solution: Enhance translation efficiency with translation enhancers like T7g10L

  • Protein solubility and membrane integration:

    • Solution: Express as fusion proteins with solubility-enhancing partners

    • Solution: Optimize growth temperature (lower temperatures may improve folding)

    • Solution: Test different detergents for extraction efficiency while maintaining activity

  • Activity assay limitations:

    • Solution: Develop GFP-based in vitro assays to correlate activity with structural observations

    • Solution: Use synthetic lipobox-containing peptides as standardized substrates

    • Solution: Employ radiolabeled substrates for enhanced sensitivity

  • Protein stability during purification:

    • Solution: Include protease inhibitors in all buffers

    • Solution: Add stabilizing agents like glycerol or specific phospholipids

    • Solution: Minimize freeze-thaw cycles by storing aliquots

  • Lactate accumulation during fermentation:

    • Solution: Implement REED™ technology for electro-dialysis of lactate

    • Solution: Develop fed-batch strategies to control lactate levels

    • Solution: Engineer strains with altered lactate metabolism

By addressing these challenges systematically, researchers can overcome the technical difficulties associated with Lgt expression and characterization, enabling more detailed structural and functional studies of this important bacterial enzyme.

What are the promising areas for future research on L. lactis Lgt and its applications?

Several high-potential research directions emerge from current knowledge:

  • Structure-based drug design:

    • Leverage the crystal structure information to design specific inhibitors of Lgt

    • Develop screening assays for identifying novel Lgt inhibitors

    • Explore species-specific targeting based on the His-to-Tyr substitution in L. lactis

  • Enhanced vaccine delivery systems:

    • Optimize recombinant L. lactis strains for improved mucosal immune responses

    • Develop multi-antigen expression systems for combination vaccines

    • Engineer strains with enhanced intestinal colonization properties

  • Protein production platform optimization:

    • Further develop the REED™ technology for higher-yield protein production

    • Engineer L. lactis strains with enhanced secretion capacity

    • Optimize signal peptides for improved heterologous protein secretion

  • Detailed mechanistic studies:

    • Investigate the catalytic mechanism of L. lactis Lgt, particularly the role of the Tyr residue

    • Perform comparative kinetic analyses across different bacterial species

    • Explore substrate specificity determinants through structural biology approaches

  • Evolutionary biology:

    • Expand phylogenetic analyses of Lgt across diverse bacterial species

    • Investigate the functional consequences of the His-to-Tyr substitution in different contexts

    • Study the co-evolution of Lgt with its substrate lipoproteins

These research directions have significant potential to advance our understanding of bacterial lipoprotein biosynthesis and leverage this knowledge for practical applications in medicine and biotechnology.

How might CRISPR-Cas technologies enhance research on L. lactis Lgt?

CRISPR-Cas systems offer powerful tools that could significantly advance L. lactis Lgt research:

  • Precise genome editing:

    • Generate clean lgt knockouts in L. lactis for complementation studies

    • Create point mutations to study specific residues without plasmid-based expression

    • Introduce reporter fusions at the native locus for physiologically relevant expression levels

  • Regulatable gene expression:

    • Implement CRISPR interference (CRISPRi) for tunable repression of lgt

    • Use CRISPR activation (CRISPRa) to enhance expression of native or recombinant lgt

    • Create conditional knockdowns to study essential gene function

  • High-throughput mutagenesis:

    • Perform saturation mutagenesis of lgt to identify all critical residues

    • Create libraries of lgt variants with altered properties

    • Screen for variants with enhanced activity or stability

  • Multi-gene editing:

    • Simultaneously modify lgt and related genes in the lipoprotein biosynthesis pathway

    • Engineer optimized expression hosts by modifying multiple genetic elements

    • Create synthetic operons for coordinated expression of lgt with substrate lipoproteins

  • In vivo tracking:

    • Tag the native lgt gene with fluorescent reporters for localization studies

    • Monitor expression dynamics under different physiological conditions

    • Study protein-protein interactions in the natural cellular context

These CRISPR-based approaches would complement traditional molecular biology techniques and potentially accelerate discovery in L. lactis Lgt research.

What potential exists for synthetic biology approaches to engineer novel functions of Lgt in L. lactis?

Synthetic biology offers exciting possibilities for engineering novel functions in L. lactis Lgt:

  • Substrate specificity engineering:

    • Modify the binding pocket to accommodate non-natural lipid substrates

    • Engineer Lgt to recognize altered lipobox sequences

    • Create enzymes capable of transferring novel functional groups

  • Cellular localization control:

    • Engineer lipid modifications that direct proteins to specific cellular compartments

    • Create orthogonal lipid modification systems for selective protein targeting

    • Develop inducible localization systems based on controlled lipidation

  • Biosensor development:

    • Engineer Lgt-based biosensors for detecting specific lipids or membrane properties

    • Create reporter systems based on successful lipid transfer

    • Develop high-throughput screening systems for Lgt inhibitors

  • Therapeutic protein delivery:

    • Engineer L. lactis to express and lipid-modify therapeutic proteins

    • Develop systems for controlled release of bioactive lipoproteins

    • Create membrane-anchored therapeutic proteins with enhanced stability

  • Metabolic engineering applications:

    • Integrate Lgt-mediated protein anchoring into synthetic metabolic pathways

    • Create artificial multienzyme complexes anchored to the membrane via Lgt-mediated lipidation

    • Engineer membrane-bound biocatalysts with enhanced stability and reusability

These synthetic biology approaches could significantly expand the utility of L. lactis beyond its traditional applications in food production and current recombinant protein expression systems, opening new avenues in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.