Recombinant Lactococcus lactis subsp. lactis Putative zinc metalloprotease LL2128 (LL2128)

Shipped with Ice Packs
In Stock

Description

Introduction to Lactococcus lactis

Lactococcus lactis is a bacterium widely recognized as safe for food applications, making it suitable for producing plasmid DNA or recombinant proteins for industrial or pharmaceutical uses . When L. lactis overproduces recombinant proteins, high gene dosage and strong promoters create stressful conditions for the cells, leading to protective reactions that can negatively impact cell metabolism, protein yield, and quality .

Zinc Metalloproteases

Metalloproteases are enzymes that utilize a metal ion, often zinc, to perform their function of cleaving peptide bonds in proteins . These enzymes are involved in numerous biological processes, including protein turnover, signal transduction, and bacterial virulence .

LL2128 as a Zinc-Dependent Metallopeptidase

LL2128 is identified as a zinc-dependent metallopeptidase in Lactococcus lactis subsp. lactis . The gene yvjB codes for this membrane-bound metallopeptidase, which suggests its potential role as a receptor for bacteriocins .

The Role of LL2128 in Bacteriocin Sensitivity

Research indicates that LL2128 is linked to the sensitivity of L. lactis to LsbB, a leaderless class II bacteriocin . Bacteriocins are antimicrobial peptides produced by bacteria to inhibit the growth of similar or closely related bacterial strains. The yvjB gene, which encodes LL2128, is crucial for LsbB sensitivity . Disruption of yvjB through gene knockout can cause LsbB resistance in sensitive strains . The heterologous expression of yvjB in naturally resistant strains can render them sensitive to bacteriocins, further supporting its role as a bacteriocin receptor .

Zinc's Role in Gene Regulation

The zitRSQP operon in L. lactis is involved in zinc uptake regulation, where ZitS, ZitQ, and ZitP form an ABC transporter for high-affinity Zn2+ uptake . The expression of this operon is regulated by environmental zinc concentrations, similar to other zinc transport operons in gram-positive bacteria .

Metalloproteases and Metal Preferences

Metalloproteases, including LL2128, often rely on zinc for their activity, but some can also bind other metals . The metal-binding motif in these enzymes dictates their metal preference and activity .

Applications of Recombinant Protein Production in L. lactis

L. lactis is employed for the production of recombinant proteins, with cell-wall anchored antigens showing promising results for live mucosal vaccination applications . Overexpression of membrane proteins in L. lactis can lead to the up-regulation of chaperones and proteases, indicating a general stress response to the accumulation of misfolded proteins .

Zinc-Controlled Expression System

The PZnzitR system, utilizing the PZn promoter and zitR repressor from the L. lactis zit operon, is a tightly regulated expression system controlled by zinc concentration . This system has been used to control the expression of heterologous genes in L. lactis, demonstrating its utility in protein production .

Adaptive Laboratory Evolution and Autolysis

Adaptive laboratory evolution can enhance thermotolerance and improve autolysis in L. lactis .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
LL2128; L181494; Putative zinc metalloprotease LL2128
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-428
Protein Length
full length protein
Species
Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Target Names
LL2128
Target Protein Sequence
MIETLITFIIIFGIIVAIHEYGHLWWAKRSGILVREYAVGMGPKIFAHQAKDGTLYTIRI LPLGGYVRLAGWGDDKTEIKKGQAASLVVSKSEVVNPEAENSVSNIVRRINLSEHVELEE AIPMLITEYDFEKELFIEGEVFGEIKRYSVDHDATIIEEDGTEVRIAPLDVQYQSAGVFH KMLTNFGGPLNNFILGIIAFIVLTFVQGGVPSTTNAIGQVEKGTPAYNAGLKAGDKIEAV NGTKTADWNNVVTEISGSKGKELKLEVSRSGKSETLSVTPKKMDGSYRVGIMQSMKTGFF DKITGGFVQAGQSATAIFKALGSLIARPSLDKLGGPVAIYQLSGQAARAGFPAIVYLLAM LSINLGIVNLFPIPVLDGGKIVLNIIEAIRGKALSQEKESIITMVGVVFMLVLFVAVTWN DILRAFVN
Uniprot No.

Target Background

Database Links

KEGG: lla:L181494

STRING: 272623.L181494

Protein Families
Peptidase M50B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and functional classification of LL2128?

LL2128 is a 428-amino acid putative zinc metalloprotease native to Lactococcus lactis subsp. lactis. As a metalloprotease, it likely contains the characteristic HEXXH zinc-binding motif common to this enzyme family, which coordinates the catalytic zinc ion essential for peptide bond hydrolysis. The protein is currently classified as "putative" because its function has been predicted through sequence homology rather than directly demonstrated through experimental characterization.

When expressed recombinantly, LL2128 is typically produced with a histidine tag to facilitate purification, as seen in commercially available versions . The full three-dimensional structure has not been reported in primary literature, though structural predictions based on homology modeling would likely show the characteristic metalloprotease fold with a catalytic domain containing the zinc-binding site.

What expression systems are most suitable for LL2128 production?

For expression in L. lactis, several systems have been developed that could be applied to LL2128:

  • The nisin-controlled expression (NICE) system, which is the most widely used and potent protein expression system in L. lactis

  • The zinc-inducible expression system (Zirex), which may be particularly suitable for a zinc metalloprotease and achieves expression levels approximately 80% of those achieved with nisin

When using L. lactis as an expression host, culture conditions typically involve growth at 30°C without shaking in GM17 media (M17 media supplemented with 0.5% glucose) . For recombinant strains, appropriate antibiotics such as spectinomycin (100 μg/ml) or erythromycin (1 μg/ml) would be added for plasmid maintenance .

How should recombinant LL2128 be purified and characterized?

Purification of recombinant His-tagged LL2128 should follow established protocols for metalloproteases, with special considerations:

  • Cell Lysis and Initial Extraction:

    • For E. coli-expressed LL2128: Sonication or high-pressure homogenization in zinc-containing buffer

    • For L. lactis-expressed LL2128: Enzymatic lysis with lysozyme in isotonic buffer

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Critical buffer components: 20-50 mM Tris-HCl (pH 7.5-8.0), 150-300 mM NaCl, 10-50 μM ZnCl₂, 10% glycerol

    • Avoid EDTA and other metal chelators in all buffers

    • Consider size exclusion chromatography as a second purification step

  • Activity Verification:

    • Zymography using casein or gelatin as substrate

    • Fluorogenic peptide assays with metalloprotease-specific substrates

    • Inhibition studies with metalloprotease inhibitors and restoration of activity with zinc

Analysis MethodPurposeKey Parameters
SDS-PAGEPurity assessment>95% for structural/functional studies
Western blottingExpression verificationAnti-His detection or LL2128-specific antibodies
Size-exclusion chromatographyOligomeric state determinationCalibrated with known standards
Circular dichroismSecondary structure analysisFar-UV spectrum (190-260 nm)
Thermal shift assayStability assessmentMelting temperature in various buffers
Activity assaysFunctional verificationpH optimum, Zn²⁺ dependency

What methods can determine the substrate specificity of LL2128?

Determining substrate specificity is crucial for understanding the biological function of LL2128. Methodological approaches include:

  • Peptide Library Screening:

    • Synthesize positional scanning peptide libraries with systematic amino acid substitutions around potential cleavage sites

    • Fluorescence-based high-throughput assays to identify preferred residues at each position

  • Mass Spectrometry-Based Approaches:

    • Incubate LL2128 with candidate substrate proteins

    • Analyze cleavage products by LC-MS/MS to determine precise cleavage sites

    • Compile results to establish a consensus cleavage motif

  • Comparative Analysis:

    • Test LL2128 activity against known substrates of well-characterized bacterial metalloproteases

    • Compare cleavage patterns with other L. lactis proteases to identify unique specificities

  • Bioinformatic Prediction and Validation:

    • Use tools like MEROPS database to predict substrates based on sequence similarity

    • Experimentally validate top candidates from computational predictions

Based on known bacterial zinc metalloproteases, LL2128 may prefer hydrophobic residues at the P1' position (immediately after the cleavage site), but experimental verification is essential for establishing its unique specificity profile.

How can expression of LL2128 in L. lactis be optimized?

Optimizing expression of LL2128 in L. lactis requires careful consideration of several factors based on research with other recombinant proteins in this host:

  • Promoter Selection:

    • The zinc-inducible Zirex system may be particularly appropriate for LL2128 as it achieves high expression levels (about 80% of the nisin system) and can be regulated by zinc addition

    • The nisin-controlled expression system (NICE) offers tightly regulated, high-level expression

    • Consider that both systems can be used simultaneously for complex expression strategies

  • Codon Optimization:

    • Adapt the LL2128 coding sequence to L. lactis codon usage preferences, particularly for high-expression scenarios

    • Remove rare codons that might limit translation efficiency

  • Signal Peptide Selection:

    • For secreted expression, the Usp45 signal peptide has been successfully used for various recombinant proteins in L. lactis

    • Consider testing both cytoplasmic and secreted versions to determine optimal yields

  • Culture Conditions:

    • Growth temperature: 30°C (standard for L. lactis)

    • Media: GM17 (M17 supplemented with 0.5% glucose)

    • Static culture conditions (L. lactis is typically grown without shaking)

    • Induction timing: mid-log phase generally yields better results

  • Monitoring Cellular Stress:

    • Overexpression of recombinant proteins in L. lactis affects its transcriptome and proteome, which may necessitate adjustments to media composition and induction parameters

    • The expression of membrane or secreted proteins (which LL2128 may be) can trigger cell envelope stress responses

How does recombinant LL2128 expression affect L. lactis metabolism?

Expression of recombinant LL2128 likely impacts L. lactis metabolism in several ways, based on studies of recombinant protein expression in this organism:

  • Metabolic Burden:

    • High copy number plasmids combined with strong promoters create metabolic stress, diverting resources from normal cellular processes

    • Growth rates are typically reduced compared to non-expressing controls

  • Transcriptome and Proteome Alterations:

    • Overexpression of membrane proteins in L. lactis negatively impacts nucleotide synthesis pathways

    • Down-regulation of glycolytic enzymes and pyruvate-dissipating enzymes is common

    • Up-regulation of genes coding for enzymes involved in peptidoglycan layer biosynthesis

  • Monitoring Parameters:

    • Growth curves to assess impact on cell proliferation

    • Plasmid stability over multiple generations

    • Cell morphology changes using microscopy

For comprehensive analysis, comparative transcriptomic or proteomic studies between induced and non-induced cultures, as well as empty vector controls, would provide insights into specific metabolic adaptations.

What biological roles might LL2128 play in L. lactis?

The biological function of LL2128 in L. lactis remains to be fully characterized, but as a putative zinc metalloprotease, it likely plays roles in protein processing, nutrient acquisition, or stress responses. To investigate its function:

  • Gene Knockout Studies:

    • Create LL2128 deletion mutants using CRISPR-Cas9 or traditional homologous recombination methods

    • Analyze phenotypic changes in growth, stress resistance, and biofilm formation

    • Test fitness under various stress conditions (acid, oxidative, osmotic)

  • Transcriptomic Analysis:

    • Perform RNA-Seq to identify conditions where LL2128 expression is regulated

    • Compare wild-type and knockout strain transcriptomes to identify compensatory changes

  • Protein Interaction Studies:

    • Use pull-down assays with tagged LL2128 to identify interacting proteins

    • Perform bacterial two-hybrid screens to map the interaction network

Given that L. lactis is widely used in dairy fermentation and as a probiotic, LL2128 might participate in:

  • Adaptation to environmental stresses (pH, temperature, oxidative)

  • Processing of secreted or cell surface proteins

  • Nutrient acquisition in milk or gut environments

  • Cell envelope maintenance and remodeling

How might LL2128 be utilized in biotechnological applications?

As a protease from a food-grade bacterium, LL2128 presents several potential biotechnological applications:

  • Protein Engineering Platform:

    • The catalytic domain could be engineered for modified substrate specificity

    • Creation of chimeric proteins combining LL2128 with domains from other proteases

  • Dairy Industry Applications:

    • Given L. lactis's GRAS status, engineered LL2128 could potentially be used in cheese ripening or texture modification

    • Development of strains with controlled proteolytic activity for consistent product quality

  • Therapeutic Protein Delivery:

    • Recombinant L. lactis strains expressing therapeutic proteins have shown promise for intestinal delivery

    • LL2128 could potentially be engineered to process bioactive peptides in situ at mucosal surfaces

  • Biocatalysis:

    • If LL2128 demonstrates unique substrate specificity, it could be employed in enzymatic processes requiring precise proteolytic cleavage

    • Immobilization on solid supports for continuous processing applications

  • Vaccine Development:

    • L. lactis has been successfully used as a vector for mucosal vaccine delivery

    • LL2128 could potentially be used to process antigens or as a carrier protein in vaccine constructs

Methodological approaches for these applications would require protein engineering through site-directed mutagenesis, activity optimization, and stability testing under relevant conditions.

What factors affect LL2128 activity and stability?

Several factors can influence the activity and stability of recombinant LL2128:

  • Metal Ion Availability:

    • As a zinc metalloprotease, LL2128 requires Zn²⁺ for activity

    • Other divalent cations (Ca²⁺, Mg²⁺) may enhance stability without participating in catalysis

    • Metal chelators (EDTA, 1,10-phenanthroline) will inhibit activity

  • pH and Temperature:

    • Optimal pH likely falls in the range of 6.0-7.5, typical for bacterial metalloproteases

    • Temperature optimum probably matches L. lactis growth temperature (30°C)

    • Stability decreases at extremes of pH and temperature

  • Autoproteolysis:

    • Self-cleavage can reduce enzyme yield and create heterogeneous preparations

    • Minimize by working at lower temperatures and including reversible inhibitors during purification

  • Storage Conditions:

    • Recommended: 10-50 μM ZnCl₂, 20-50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% glycerol

    • Storage at -80°C in small aliquots to avoid freeze-thaw cycles

    • Addition of stabilizers such as bovine serum albumin (0.1-1 mg/mL) may improve long-term stability

  • Expression-Related Issues:

    • Insoluble aggregates may form if expression levels are too high

    • Co-expression with bacterial chaperones may improve folding

    • Expression temperature optimization is critical (lower temperatures generally favor proper folding)

How can researchers distinguish between LL2128 and other L. lactis proteases?

Distinguishing LL2128 activity from other L. lactis proteases requires careful experimental design:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.