Recombinant Lactococcus lactis subsp. lactis Uncharacterized protein YrjE (yrjE)

Shipped with Ice Packs
In Stock

Description

Production and Purification

YrjE is typically secreted into the culture medium when expressed in L. lactis, simplifying downstream purification . In E. coli, cytoplasmic expression requires cell lysis and affinity chromatography (e.g., Ni-NTA for His-tagged proteins) . Key steps include:

  • Cloning: Codon optimization is unnecessary for L. lactis .

  • Fermentation: Yields vary based on host strain and culture conditions. L. lactis achieves 0.1–10 mg/L for complex proteins .

  • Stress Responses: Overexpression in L. lactis upregulates cell envelope stress pathways (e.g., CesSR regulon) and peptidoglycan biosynthesis genes .

Research Applications

Though functionally uncharacterized, YrjE’s production aligns with broader trends in recombinant protein applications:

  • Antigen Production: Used in ELISA kits for antibody detection .

  • Structural Studies: Potential target for crystallography due to its membrane-associated motifs .

  • Host Physiology Studies: Serves as a model to investigate L. lactis’s stress responses during heterologous expression .

Challenges in Production

  • Yield Limitations: Proteins with high cysteine content or complex secondary structures show reduced expression (e.g., 0.1–2 mg/L for cysteine-rich antigens) .

  • Stress Adaptation: Membrane protein overexpression downregulates glycolysis and nucleotide synthesis genes, impairing growth .

  • Fusion Strategies: Disordered carrier proteins (e.g., GLURP-R0) improve solubility for difficult targets .

Comparative Advantages of L. lactis

FactorL. lactis AdvantageReference
SafetyGRAS status; no endotoxin production
Secretion EfficiencyDirect release into culture medium reduces purification costs
GlycosylationAvoids unwanted post-translational modifications
Codon UsageNo optimization required for most prokaryotic/eukaryotic genes

Future Directions

Current research gaps include elucidating YrjE’s native role in L. lactis and exploring its potential in vaccine development or industrial enzymology. Advances in fusion protein design and stress-tolerant L. lactis strains could enhance production efficiency .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
yrjE; LL1736; L177346; Uncharacterized protein YrjE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Target Names
yrjE
Target Protein Sequence
MNDNNVIFDQRSDGLNAFFSKIYALMGAGVLVSALVSWIMITFFLDNMTAILQSGSLFFL VLWIIPLVMVVSLQGLAMKNSKMALPIFIGYAAFMGFLISFTLLMYTATDITLAFVTAAA MFFGLSVYGRFTKRNLSAMGKAFGVAVWGLIIAMFLNFFFASTGLTILISLVGVVIFAGL IAWDNQKITQVYNANNGQVSDGWAISMALSLYLDFINMFLFLLRLFGIAGGNRD
Uniprot No.

Target Background

Database Links

KEGG: lla:L177346

STRING: 272623.L177346

Protein Families
BI1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are typically used for recombinant Lactococcus lactis proteins?

Lactococcus lactis itself serves as an excellent host for heterologous protein expression, particularly for membrane proteins. The nisin-inducible expression system (NICE) is commonly employed, where protein production is induced by adding nisin to the growth medium during the mid-exponential phase (typically at OD₆₀₀ = 0.5). This system has demonstrated significant production capabilities, with some recombinant proteins accounting for up to 21% of the membrane protein fraction within two hours after induction .

For expression, the gene of interest is typically cloned into appropriate vectors, often containing a histidine tag (H6) for purification. The production is monitored through careful timing after induction, with samples collected at various intervals to track expression levels. The use of L. lactis is particularly advantageous for membrane proteins that may be difficult to express in other systems such as E. coli .

What are the optimal storage conditions for recombinant YrjE protein preparations?

Based on standard protocols for similar recombinant proteins from L. lactis, purified YrjE protein should be stored in a Tris-based buffer containing 50% glycerol, optimized specifically for this protein. For short-term storage, aliquots can be maintained at 4°C for up to one week. For extended preservation, storage at -20°C is recommended, with -80°C being optimal for long-term archival.

Importantly, repeated freeze-thaw cycles should be avoided as they can cause protein degradation and loss of activity. Therefore, it is advisable to prepare small working aliquots for routine experiments while keeping the bulk of the preparation at lower temperatures. This approach preserves the structural integrity and functional properties of the protein for subsequent experimentation .

How can researchers optimize the overexpression of membrane proteins like YrjE in Lactococcus lactis?

Optimizing membrane protein overexpression in L. lactis requires attention to several key factors:

Strain Selection and Engineering:

  • Use L. lactis NZ9000 as a starting strain, which has demonstrated high capacity for membrane protein production

  • Consider overexpressing the CesSR two-component system, which has been shown to significantly improve production yields by helping the cell manage membrane protein insertion stress

  • Maintain intact key genes from the CesSR regulon, particularly ftsH, oxaA2, llmg_2163, and rmaB, as knockouts of these genes severely hamper growth and protein production capacity

Expression Conditions:

  • Induce protein expression during mid-exponential phase (OD₆₀₀ = 0.5) for optimal results

  • Carefully titrate nisin concentration for induction to balance expression levels with cell viability

  • Consider lower growth temperatures (30°C) to slow protein synthesis and allow proper folding

Monitoring Protocol:

  • Track protein production at regular intervals post-induction (15 min, 30 min, 1 hour, 2 hours)

  • Assess both membrane fraction and whole-cell fractions to determine localization efficiency

  • Use SDS-PAGE and Western blotting with antibodies against the fusion tag for quantification

Implementing these strategies can significantly improve production yields, potentially achieving up to 21% of the target protein in the membrane protein fraction within 2 hours of induction.

What purification methodologies are most effective for isolating recombinant YrjE protein while maintaining its native conformation?

Purification of membrane proteins like YrjE requires specialized approaches to maintain structural integrity:

Purification StepMethodologyCritical Parameters
Membrane IsolationDifferential centrifugationCell disruption by sonication or French press; Buffer pH 7.4-8.0 with protease inhibitors
SolubilizationDetergent extractionDDM (n-Dodecyl β-D-maltoside) at 1-2%; Temperature 4°C; Incubation time 1-2 hours
Affinity ChromatographyNi-NTA for His-tagged proteinsImidazole gradient 20-500 mM; Flow rate 0.5-1 ml/min
Size ExclusionGel filtrationBuffer containing 0.05-0.1% detergent; HEPES or Tris buffer (pH 7.4)
Quality AssessmentCircular dichroism, SEC-MALSSecondary structure confirmation; Monodispersity analysis

For YrjE specifically, maintaining the protein in a detergent micelle environment throughout purification is essential to prevent aggregation. The purification tag used (likely histidine) should be leveraged for initial capture, but the choice of detergent is crucial - a screen of different detergents (DDM, LMNG, DMNG) may be necessary to identify optimal conditions for YrjE stability.

For functional studies, consider reconstitution into proteoliposomes or nanodiscs following purification, which may better mimic the native membrane environment and preserve protein activity.

What are the most reliable methods for characterizing the membrane topology and potential function of uncharacterized proteins like YrjE?

Characterizing uncharacterized membrane proteins like YrjE requires a multi-faceted approach:

Membrane Topology Determination:

  • Computational prediction using tools like TMHMM, MEMSAT, and Phobius to predict transmembrane segments

  • Cysteine scanning mutagenesis with accessibility labeling to experimentally map exposed regions

  • Protease protection assays to identify protected (membrane-embedded) versus exposed domains

  • Fluorescence reporter fusions at N- and C-termini to determine their cellular localization

Functional Characterization:

  • Gene knockout studies to assess phenotypic changes and potential essentiality

  • Transcriptomic analysis under various stress conditions to identify co-regulated genes

  • Transport assays using radioisotope-labeled substrates if YrjE is suspected to be a transporter

  • Bacterial two-hybrid screens to identify potential protein interaction partners

Structural Analysis:

  • Cryo-electron microscopy for purified protein in detergent or lipid nanodiscs

  • X-ray crystallography if the protein can be crystallized

  • NMR spectroscopy for dynamic structural information

By integrating computational predictions with experimental data from these complementary approaches, researchers can build a comprehensive model of YrjE's topology, interactions, and potential function within the L. lactis membrane system.

How might researchers utilize recombinant L. lactis expressing YrjE to investigate bacterial adaptation to environmental stresses?

L. lactis expressing modified versions of YrjE could serve as an excellent model system for investigating bacterial stress responses, particularly those related to membrane integrity. A systematic research approach would include:

Stress Response Analysis:

  • Engineer L. lactis strains with varying YrjE expression levels (wildtype, overexpression, deletion)

  • Subject these strains to diverse environmental stressors (acid stress, osmotic pressure, detergents, antibiotics)

  • Monitor growth kinetics, membrane permeability, and cell morphology changes

  • Perform transcriptomic and proteomic analyses to identify pathways modulated by YrjE under stress

Membrane Physiology Investigation:

  • Measure membrane fluidity using fluorescence anisotropy in YrjE-variant strains

  • Assess lipid composition changes using lipidomics approaches

  • Determine if YrjE plays a role in proton motive force maintenance using fluorescent probes

These investigations would provide valuable insights into how uncharacterized membrane proteins contribute to bacterial adaptation mechanisms, potentially revealing new targets for antimicrobial development or strain improvement for biotechnological applications.

What insights can comparative genomic approaches provide about the evolutionary conservation and potential function of YrjE across Lactococcus species?

Comparative genomics offers powerful tools to contextualize YrjE function through evolutionary analysis:

Homology and Synteny Analysis:

  • Identify YrjE homologs across different Lactococcus species and related lactic acid bacteria

  • Compare sequence conservation patterns, particularly in transmembrane regions versus loop domains

  • Analyze the genomic context surrounding yrjE to identify consistently co-localized genes that may be functionally related

  • Construct phylogenetic trees to understand the evolutionary history of the protein family

Selection Pressure Analysis:

  • Calculate dN/dS ratios across different protein regions to identify domains under purifying or diversifying selection

  • Map conserved amino acid residues onto predicted structural models to identify potentially functional sites

  • Compare YrjE conservation patterns between dairy-associated versus plant-associated Lactococcus strains to identify habitat-specific adaptations

Based on these approaches, researchers could generate testable hypotheses about YrjE function and determine if it belongs to a known membrane protein family with characterized members in other bacterial species.

How can biotechnology leverage recombinant L. lactis expressing therapeutic proteins for treating inflammatory bowel diseases, and what methodological improvements are needed?

Recent research demonstrates the potential of recombinant L. lactis as a delivery vehicle for therapeutic proteins to treat inflammatory bowel diseases (IBD). Based on studies with similar applications, several methodological approaches can be optimized:

Delivery System Development:

  • Engineer L. lactis strains with strong constitutive or environmentally-responsive promoters specific to gut conditions

  • Optimize secretion signals or surface display systems for effective delivery of therapeutic proteins to intestinal mucosa

  • Develop encapsulation technologies to protect bacteria during gastric transit while allowing release in the intestine

Therapeutic Efficacy Enhancement:

  • Combine intrinsic immunomodulatory properties of L. lactis with targeted therapeutic proteins

  • Monitor multiple inflammatory parameters simultaneously, including:

    • Intestinal barrier function (permeability, secretory IgA levels, mucin expression)

    • Inflammatory markers (TNF, IFNγ, IL-17, MPO activity)

    • Histological assessment of tissue integrity

    • Microbiota composition analysis via 16S rRNA sequencing

Clinical Translation Considerations:

  • Establish reproducible dosing regimens (10⁹ CFU/mL has shown efficacy in mouse models)

  • Develop stability-enhancing modifications for improved shelf-life

  • Implement biocontainment strategies to address regulatory concerns about genetically modified organisms

One promising example is L. lactis delivering p62 protein, which demonstrated significant anti-inflammatory effects in a colitis model by increasing goblet cell counts, upregulating Muc2 gene expression, and downregulating pro-inflammatory cytokines TNF and IFNγ .

What are the common technical challenges in expressing uncharacterized membrane proteins like YrjE, and how can they be addressed?

Membrane protein expression presents several recurring challenges that researchers should anticipate:

Toxicity Issues:

  • Problem: Membrane protein overexpression often causes growth inhibition or cell death

  • Solution: Utilize the CesSR two-component system overexpression approach, which has been shown to mitigate growth defects during membrane protein production in L. lactis

  • Implementation: Co-express the cesSR genes alongside the target protein using compatible plasmids or integrate them into the chromosome with appropriate regulatory elements

Protein Misfolding:

  • Problem: Membrane proteins frequently misfold when overexpressed

  • Solution: Optimize expression temperature and induction timing; consider fusion partners that enhance folding

  • Implementation: Test expression at various temperatures (25°C, 30°C) and induce at different growth phases (early, mid, late exponential)

Low Yields:

  • Problem: Many membrane proteins express at levels too low for structural or functional studies

  • Solution: Screen multiple constructs with varying tags, linkers, and truncations

  • Implementation: Create a library of constructs with systematic variations in the N-terminal and C-terminal regions

Verification Challenges:

  • Problem: Confirming proper membrane insertion and folding is difficult

  • Solution: Employ activity assays or binding studies specific to the predicted function class

  • Implementation: If YrjE is predicted to be a transporter, develop assays measuring transport of various substrates across membranes

Researchers should implement a systematic optimization approach, testing multiple variables simultaneously using a design-of-experiments methodology to efficiently identify optimal conditions for YrjE expression.

How can researchers accurately differentiate between experimental artifacts and genuine biological effects when studying recombinant YrjE function?

Distinguishing true biological functions from artifacts requires rigorous experimental design and appropriate controls:

Control Strategies Table:

Potential ArtifactControl ApproachImplementation Method
Tag interferenceTag-free constructsCompare His-tagged vs. untagged protein function
Alternative tag positionsTest N-terminal vs. C-terminal tagged versions
Expression level artifactsTitration experimentsTest function across expression level gradient
Inducible vs. constitutiveCompare different expression systems
Host adaptation effectsMultiple host strainsExpress in different L. lactis backgrounds
Complementation studiesTest if YrjE restores function in knockout strains
Non-specific effectsInactive mutantsGenerate point mutations in predicted functional residues
Specificity controlsTest related but distinct proteins from same family

Validation Approaches:

  • Use orthogonal techniques to confirm each observation (e.g., both functional assays and binding studies)

  • Perform dose-response experiments to establish biological relevance of observed effects

  • Implement time-course studies to distinguish primary from secondary effects

  • Utilize isotope-labeled substrates to directly track molecular interactions

By systematically implementing these controls and validation strategies, researchers can build a convincing case for the true biological function of YrjE while avoiding common pitfalls in membrane protein characterization.

What strategies can be employed to overcome the challenges of studying protein-protein interactions involving membrane proteins like YrjE?

Investigating protein-protein interactions (PPIs) for membrane proteins presents unique challenges that require specialized approaches:

In Vivo Interaction Methods:

  • Modified bacterial two-hybrid systems optimized for membrane proteins (BACTH)

  • Split-GFP complementation assays with membrane-compatible linkers

  • Protein-fragment complementation assays (PCA) using reporters that function in membrane environments

  • Förster resonance energy transfer (FRET) with membrane-localized fluorescent proteins

In Vitro Approaches:

  • Pull-down assays using detergent-solubilized proteins with appropriate controls for non-specific binding

  • Surface plasmon resonance (SPR) with the membrane protein reconstituted in nanodiscs or proteoliposomes

  • Isothermal titration calorimetry (ITC) adapted for membrane protein systems

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

Cross-Linking Strategies:

  • Chemical cross-linking coupled with mass spectrometry (XL-MS) using membrane-permeable cross-linkers

  • Photo-reactive amino acid incorporation at specific positions followed by crosslinking and identification

  • In vivo crosslinking during expression followed by stringent purification under denaturing conditions

Computational Support:

  • Molecular docking simulations incorporating membrane environments

  • Coevolutionary analysis to predict interaction interfaces based on correlated mutations

  • Network analysis of transcriptomic data to identify functionally related proteins

When applying these methods to YrjE, researchers should begin with broader approaches to identify potential interaction partners, then utilize more specific techniques to validate and characterize the most promising interactions. The integration of multiple complementary approaches increases confidence in the identified interactions.

How might synthetic biology approaches be used to engineer novel functions into L. lactis strains expressing modified YrjE proteins?

Synthetic biology offers exciting possibilities for engineering novel functions through YrjE modifications:

Domain Swapping and Chimeric Proteins:

  • Create chimeric constructs by fusing functional domains from characterized transporters or receptors to YrjE scaffolds

  • Design transmembrane biosensors by incorporating ligand-binding domains that trigger conformational changes

  • Engineer synthetic signaling pathways where modified YrjE serves as a membrane-anchored signal transduction component

Directed Evolution Applications:

  • Develop high-throughput screening systems to evolve YrjE variants with enhanced stability or novel substrate specificity

  • Apply continuous evolution systems with selective pressure for specific functions

  • Use deep mutational scanning to comprehensively map sequence-function relationships

Potential Applied Outcomes:

  • Engineered L. lactis strains with enhanced nutrient uptake capabilities for improved growth in industrial fermentations

  • Designer probiotics that can sense specific gut conditions and respond with therapeutic protein production

  • Novel biosensors for detecting environmental contaminants or metabolites

This synthetic biology approach could transform an uncharacterized protein like YrjE into a valuable chassis for membrane protein engineering, enabling new applications in biotechnology, medicine, and environmental monitoring.

What role might YrjE play in the development of enhanced recombinant protein production systems in L. lactis?

Understanding YrjE's function could potentially enhance recombinant protein production strategies:

If YrjE is involved in membrane stress responses:

  • Its overexpression might improve cell resilience during high-level recombinant protein production

  • Co-expression with challenging membrane proteins could enhance yields

  • Understanding its regulatory network might reveal new targets for strain engineering

If YrjE functions as a transporter:

  • It could be exploited to enhance nutrient uptake during high-density fermentations

  • Modified variants might improve export of secreted recombinant proteins

  • YrjE could be used to develop new selection markers for strain development

Integration with existing enhancement systems:

  • Combined overexpression with the CesSR system, which has already demonstrated significant improvements in membrane protein production

  • Coordination with other stress response systems to create robust production hosts

  • Development of designer regulatory circuits incorporating YrjE and its interacting partners

Research into these applications would benefit from systematic phenotypic analysis of YrjE overexpression and knockout strains under various production conditions, followed by transcriptomic and proteomic studies to understand the broader impacts on cellular physiology.

How can advanced structural biology techniques be applied to resolve the structure-function relationship of YrjE and similar uncharacterized membrane proteins?

Resolving membrane protein structures remains challenging but several cutting-edge approaches show promise:

Cryo-Electron Microscopy Advancements:

  • Single-particle cryo-EM with improved detectors and processing algorithms for smaller membrane proteins

  • Cryo-electron tomography for visualizing YrjE in its native membrane environment

  • Focused ion beam milling combined with cryo-ET for visualizing proteins within cellular contexts

Integrative Structural Biology:

  • Combining lower-resolution cryo-EM maps with computational modeling and molecular dynamics simulations

  • Leveraging evolutionary coupling analysis (EVCouplings) to predict contact maps as constraints for structure prediction

  • Using AlphaFold2 and RoseTTAFold predictions as starting models, refined with experimental data

Innovative Crystallization Approaches:

  • Lipidic cubic phase crystallization optimized for bacterial transporters

  • Crystallization in complex with stabilizing nanobodies or synthetic binding proteins

  • Serial crystallography at X-ray free-electron lasers (XFELs) for microcrystals

Functional Correlation Studies:

  • High-throughput site-directed mutagenesis coupled with functional assays to map critical residues

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions and binding interfaces

  • Solid-state NMR studies of reconstituted YrjE to obtain distance constraints and dynamics information

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.