Recombinant Lactococcus lactis subsp. lactis UPF0177 protein yajF (yajF)

What is the Recombinant Lactococcus lactis subsp. lactis UPF0177 protein yajF?

Recombinant Lactococcus lactis subsp. lactis UPF0177 protein yajF (Q9CJB0) is a full-length protein (1-201 amino acids) that can be expressed with an N-terminal His tag in E. coli. The protein belongs to the UPF0177 family, and while its precise function remains under investigation, it is being studied for potential roles in bacterial physiology and applications in biotechnology. The recombinant form allows researchers to produce and purify this protein for detailed structural and functional studies without needing to extract it directly from native Lactococcus lactis cultures .

What is the complete amino acid sequence of yajF protein?

The full protein consists of 201 amino acids with the following sequence:
MINIWNKSKTVILALFLLFLSQVPLYYVEYENERQNLFGVANKITVNFILIGLLIILIAI MLGIKNGFYKNAKRTLEWKNIILILILIIPSVALDILFSQFIQFHHLGRMDNQIAIDSVM GSLLWFGKILGVALLAPILEESIFRASIYKIFSNNKIAFVFSSLLFTFMHSGYSWVFLIY LPMSLAVTFIYHRRSDVILKS

This primary structure can be used as a reference for protein validation after expression and purification, and serves as the foundation for structural and functional analysis experiments.

How should researchers approach initial characterization of yajF protein structure?

For initial characterization, researchers should employ multiple complementary techniques:

• Secondary structure prediction: Using computational tools to analyze the amino acid sequence for potential structural elements.

• Circular dichroism (CD) spectroscopy: To experimentally determine secondary structure composition (α-helices, β-sheets).

• Size exclusion chromatography: To determine the oligomeric state of the native protein.

• Limited proteolysis coupled with mass spectrometry: To identify stable domains and flexible regions.

Based on the amino acid sequence analysis, yajF appears to contain transmembrane segments, suggesting membrane association that would require specialized biochemical approaches for structural studies .

What expression systems are optimal for recombinant production of yajF protein?

While E. coli is the predominant expression system for yajF protein as evidenced in the literature, researchers should consider several factors when selecting an expression system:

E. coli expression (standard method):

• Advantages: Rapid growth, high yields, well-established protocols

• Protocol highlights: The protein can be expressed with an N-terminal His-tag in E. coli using standard induction protocols .

• Purification strategy: Immobilized metal affinity chromatography (IMAC) leveraging the His-tag.

Alternative expression in L. lactis:

• Advantages: Native-like post-translational modifications, potentially better folding

• Method comparison: While more complex than E. coli expression, this approach may be valuable for functional studies where native conformation is critical.

• Applications: Particularly suitable when studying yajF in the context of L. lactis biological functions or when using L. lactis as a delivery vector .

What are the recommended storage conditions for maintaining yajF protein stability?

Based on established protocols, the following storage conditions should be implemented:

Researchers should note that repeated freeze-thaw cycles significantly reduce protein activity and should be avoided. The addition of 50% glycerol (final concentration) is recommended as a cryoprotectant for samples stored at -20°C/-80°C .

How can yajF protein be incorporated into Lactococcus lactis genetic engineering studies?

Researchers can incorporate yajF into L. lactis genetic engineering through several methodologies:

• Homologous expression approach: Similar to strategies used for cdaA gene expression in L. lactis, where the gene is amplified and cloned into appropriate vectors (e.g., pBV153) with promoters that allow regulated expression .

• Co-expression with antigens or adjuvants: Follow established protocols for creating multi-functional L. lactis strains that express both a protein of interest (like yajF) and other functional molecules. This approach has been successful in developing vaccine prototypes and immunomodulatory systems .

• Promoter selection: Use of the Pcit promoter allows pH-regulated expression, while the Pnis promoter provides nisin-inducible expression. Both systems have been validated in L. lactis genetic engineering applications .

The phenotypic impact of gene expression can be monitored through growth curves in rich-medium (such as M17G) and stress response testing under various conditions (saline sensitivity, antibiotic compounds exposure) .

What analytical techniques should be employed to verify yajF protein integrity and activity?

For comprehensive characterization, researchers should employ multiple analytical approaches:

• SDS-PAGE: For purity assessment (should be >90%) and molecular weight confirmation .

• Western blotting: Using anti-His antibodies to verify the presence of the tagged protein.

• Mass spectrometry: For accurate molecular weight determination and protein identification.

• Functional assays: Based on the predicted role of yajF in cellular processes.

• Circular dichroism: To assess proper folding and secondary structure elements.

Additionally, researchers should evaluate the activity in both in vitro and cellular contexts, depending on the specific hypotheses regarding yajF function.

How might yajF be utilized in developing novel mucosal vaccine systems?

Building on established L. lactis vaccine prototype research, yajF could be integrated into vaccine development through:

• Expression as an antigenic protein: If yajF has antigenic properties, it could be expressed in L. lactis similar to the trans-sialidase (TScf) model described in literature. This would involve optimization of expression using appropriate promoters like Pnis .

• Co-expression with immunomodulatory molecules: Following the bipartite strategy where one strain expresses the antigen and another produces an adjuvant (like c-di-AMP). This approach has demonstrated effectiveness in eliciting specific immune responses in previous studies .

• Development of single-plasmid systems: Engineering L. lactis strains containing a single plasmid with multiple genes under different promoters allows for simultaneous production of antigen and adjuvant. This simplifies vaccine formulation while maintaining efficacy .

Researchers should evaluate immune responses through both humoral and cellular assays, such as the delayed-type hypersensitivity (DHT) test, which can provide a rapid assessment of cellular immune response despite certain limitations .

What roles might yajF play in bacterial stress response and homeostasis?

While specific functions of yajF remain under investigation, researchers can design experiments based on related bacterial proteins:

• Stress response assays: Testing bacterial growth under various stressors (salt, antibiotics, lysozyme) with normal versus elevated yajF expression. Similar approaches with other L. lactis proteins have revealed phenotypic impacts like saline hypersensitivity .

• Metabolic function analysis: Investigating potential roles in homofermentative metabolism, which is significant in L. lactis for lactic acid production from sugars .

• Anti-inflammatory properties: Assessing whether yajF contributes to the documented anti-inflammatory effects of L. lactis, particularly through modulation of nitric oxide and cytokine production .

These investigations would provide insight into whether yajF contributes to the probiotic and industrial applications of L. lactis in ways similar to other characterized proteins in this bacterium.

What are common challenges in recombinant yajF protein expression and purification?

Several technical challenges may arise during yajF work:

Researchers should verify protein purity through SDS-PAGE (aiming for >90% purity) and implement the recommended reconstitution and storage protocols to maintain protein stability and functionality .

How can researchers optimize functional assays for yajF protein?

When developing functional assays for yajF:

• Begin with bioinformatic analysis: Use sequence homology and structural predictions to inform potential functions that can be tested experimentally.

• Design appropriate controls: Include both positive and negative controls in all assays, particularly:

  • Heat-inactivated yajF protein (negative control)

  • Known functional homologs (positive control)

  • Wild-type L. lactis versus engineered strains with modified yajF expression

• Consider cellular context: When studying membrane-associated proteins like yajF, reconstitution into liposomes or membrane mimetics may be necessary to observe native-like activity.

• Start with established L. lactis functional assays: Leverage methodologies used for other L. lactis proteins, such as those used to characterize CdaA activity and phenotypic impacts, which have revealed growth pattern changes and stress response variations .