Recombinant Lactococcus lactis subsp. lactis UPF0177 protein ybdJ (ybdJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes and we will strive to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please communicate this to us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
In general, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotting is recommended to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a preferred tag type, please inform us and we will prioritize its inclusion in the development process.
Synonyms
ybdJ; LL0135; L136552; UPF0177 protein YbdJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Target Names
ybdJ
Target Protein Sequence
MIERIKKFLRTKFKPLLLLLVTVILYNGWTPHLGIFPPTFYDFAFNYYGFVDILTFLVII VIAYKNDAFKKIFDIFRPKNLLFILFFIVGGNIFIALAHHLYFQMTPALEAFPEHSIDLA NYFARTPFWTHSLDLFVIGPISEELIYREYLYRLFDKKCLACFVSVTMFAWVHTGFTYSF FLYLPISLVVTLAYHRRKAIGESIALHSSINLINTYLPNLLSFWVF
Uniprot No.

Target Background

Database Links

KEGG: lla:L136552

STRING: 272623.L136552

Protein Families
UPF0177 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0177 protein ybdJ in Lactococcus lactis?

UPF0177 protein ybdJ is a 226-amino acid membrane protein encoded by the ybdJ gene in Lactococcus lactis subsp. lactis strain IL1403. The "UPF" designation indicates it belongs to an Uncharacterized Protein Family, suggesting its precise function remains to be fully elucidated. Bioinformatic analysis indicates this protein contains multiple transmembrane segments, consistent with its localization in the bacterial cell membrane. The protein has been assigned the UniProt accession number Q9CJ66, and is part of a conserved family of bacterial membrane proteins .

What are the predicted structural features of UPF0177 protein ybdJ?

Based on computational analysis, UPF0177 protein ybdJ contains several key structural features:

FeatureDescriptionPosition
Transmembrane helicesMultiple hydrophobic segments spanning the membraneDistributed throughout the protein
N-terminal regionContains potential signal sequenceResidues 1-30
Cytoplasmic loopsCharged regions connecting transmembrane segmentsBetween TM regions
Extracellular domainsPortions exposed to the cell exteriorBetween TM regions
C-terminal domainMay be involved in protein-protein interactionsResidues 216-226

The protein's transmembrane topology suggests it may function in membrane transport, signaling, or maintenance of membrane integrity .

What expression systems are optimal for recombinant UPF0177 protein ybdJ production?

Lactococcus lactis itself serves as an ideal expression host for recombinant UPF0177 protein ybdJ due to several advantages over other bacterial expression systems:

  • GRAS (Generally Recognized as Safe) status, allowing safer handling in laboratory settings

  • Rapid growth to high cell densities without requiring aeration, facilitating large-scale fermentation

  • Absence of endotoxins due to its Gram-positive nature

  • Limited protease activity, resulting in higher yields of intact recombinant proteins

  • Availability of diverse expression vectors with various regulatory elements

For membrane proteins like ybdJ, L. lactis offers particular advantages as it provides a native-like membrane environment that may enhance proper folding and insertion. Expression in the original host also minimizes issues related to codon usage and toxicity that might occur in heterologous systems .

Which promoter systems provide the best control for ybdJ expression?

Several promoter systems have been optimized for recombinant protein expression in L. lactis, each with distinct advantages for membrane protein expression:

Promoter SystemRegulation MechanismAdvantagesConsiderations for ybdJ
NICE (PnisA)Nisin-inducibleTight, dose-dependent regulationOptimal for potentially toxic membrane proteins
PcitpH-controlledExpression increases at acidic pHNatural pH drop during fermentation provides automatic induction
P170pH-dependentWell-characterized for industrial applicationsProven effectiveness for complex proteins
P32ConstitutiveSimple protocol, no inducer neededMay cause toxicity with membrane proteins

For membrane proteins like ybdJ, the pH-controlled Pcit promoter has shown particular promise, as demonstrated in studies with other membrane proteins in L. lactis. This system allows expression to be modulated by controlling the medium pH, providing a simple but effective regulation method .

What are the critical steps in purifying recombinant UPF0177 protein ybdJ?

Purification of membrane proteins like ybdJ requires specialized protocols:

  • Membrane Isolation:

    • Harvest cells and disrupt using mechanical or enzymatic methods

    • Separate membranes by ultracentrifugation (100,000 × g, 1 hour, 4°C)

    • Wash membrane fraction to remove peripheral proteins

  • Solubilization Optimization:

    • Screen detergents systematically (DDM, LMNG, CHAPS are good starting points)

    • Include stabilizing agents (glycerol 10-20%, specific lipids)

    • Optimize detergent:protein ratio and incubation conditions

  • Affinity Chromatography:

    • Use affinity tags (His6, Strep-tag II) positioned to avoid interfering with membrane domains

    • Maintain detergent above critical micelle concentration in all buffers

    • Reduce flow rates compared to soluble protein purification

    • Consider on-column detergent exchange if necessary

  • Quality Assessment:

    • Analyze by SDS-PAGE and Western blotting

    • Evaluate homogeneity by size exclusion chromatography

    • Confirm proper folding through circular dichroism or limited proteolysis

The detailed protocol presented in methodological references emphasizes the importance of maintaining the cold chain throughout purification and avoiding detergent depletion, which can lead to protein aggregation.

How can researchers investigate the membrane topology of UPF0177 protein ybdJ?

Determining the membrane topology of ybdJ is crucial for understanding its function. Several complementary approaches can be employed:

  • Computational Prediction:

    • Hydropathy analysis to identify potential transmembrane segments

    • Topology prediction algorithms (TMHMM, Phobius, TOPCONS)

    • Comparison with homologous proteins of known topology

  • Experimental Verification Methods:

    • Cysteine scanning mutagenesis: Introduce cysteine residues at various positions and probe accessibility with membrane-impermeable labeling reagents

    • Protease protection assays: Treat intact cells or inside-out vesicles with proteases to identify protected regions

    • Reporter fusions: Create fusions with reporters like GFP or alkaline phosphatase at different positions

  • Advanced Structural Methods:

    • Cryo-electron microscopy of membrane preparations

    • Solid-state NMR of reconstituted protein

The implementation of multiple approaches provides more reliable topology models than any single method alone, which is particularly important for novel membrane proteins like ybdJ.

What phenotypic effects are observed when UPF0177 protein ybdJ expression is altered?

Altered expression of membrane proteins in L. lactis has been shown to produce several phenotypic changes that may be relevant to ybdJ research:

  • Growth Characteristics:

    • Overexpression typically extends growth time by approximately 4 hours to reach similar biomass as control strains

    • Reduced maximum growth rate (μmax) is commonly observed

  • Stress Responses:

    • Increased sensitivity to osmotic stress (0.25 M NaCl)

    • Enhanced susceptibility to cell wall-targeting agents (lysozyme 0.10 μg/ml)

    • Altered antibiotic sensitivity profiles (ampicillin 0.25 μg/ml, penicillin 0.10 μg/ml, vancomycin 0.50 μg/ml)

  • Membrane Properties:

    • Changes in membrane fluidity and integrity

    • Altered proton permeability

    • Modified surface charge characteristics

These phenotypic effects provide clues to potential functional roles of ybdJ in cellular processes such as membrane homeostasis, stress response, or cell envelope maintenance.

How can site-directed mutagenesis be applied to study UPF0177 protein ybdJ function?

Site-directed mutagenesis provides powerful insights into structure-function relationships of membrane proteins. For ybdJ research, consider these strategic approaches:

  • Target Selection Criteria:

    • Conserved residues identified through sequence alignments across bacterial species

    • Charged residues within predicted transmembrane segments (often functionally important)

    • Potential ligand-binding sites based on structural predictions

    • Residues in predicted functional domains

  • Types of Mutations to Consider:

    • Conservative substitutions to probe structural requirements

    • Charge neutralization or reversal to investigate electrostatic interactions

    • Cysteine substitutions for accessibility and crosslinking studies

    • Deletion of specific domains to determine their necessity

  • Functional Validation:

    • Compare growth phenotypes of mutants under various stress conditions

    • Assess protein stability and membrane integration

    • Evaluate protein-protein interactions with potential partners

    • Measure changes in membrane properties

How can UPF0177 protein ybdJ be utilized in vaccine development with L. lactis?

L. lactis has been extensively developed as a mucosal vaccine delivery system, with over 20 years of research supporting this approach . UPF0177 protein ybdJ could potentially contribute to these applications in several ways:

  • Antigen Presentation Systems:

    • Fusion proteins linking ybdJ (or portions thereof) with vaccine antigens may facilitate surface display

    • If ybdJ contains extracellular domains, these regions could be engineered as antigen carriers

    • The membrane-anchoring properties of ybdJ might be exploited to create stable antigen presentation platforms

  • Expression System Optimization:

    • Understanding ybdJ regulation could inform promoter selection for optimal antigen expression

    • If ybdJ is involved in stress responses, modulating its expression might enhance L. lactis survival and delivery capacity

  • Delivery System Enhancement:

    • L. lactis expressing engineered ybdJ-antigen fusions could be administered orally, nasally, or through other mucosal routes

    • The GRAS status of L. lactis makes it particularly attractive for vaccine applications

Research has demonstrated that L. lactis can successfully deliver antigens to mucosal surfaces and elicit specific immune responses. For example, studies have shown that oral administration of engineered L. lactis strains can trigger antigen-specific immune responses against various pathogens .

What advantages does L. lactis offer as an expression system for membrane proteins like ybdJ?

L. lactis provides several distinct advantages for membrane protein expression compared to other bacterial systems:

  • Cellular Characteristics:

    • Gram-positive cell envelope simplifies membrane protein extraction

    • Lower proteolytic activity preserves intact membrane proteins

    • Natural capacity to secrete proteins indicates effective membrane trafficking machinery

  • Expression Parameters:

    • Growth without aeration simplifies large-scale cultivation

    • Diverse expression vectors allow optimization of expression conditions

    • Availability of pH-controlled promoters that can be regulated by natural fermentation processes

  • Protein Quality:

    • Properly folded and functionally active membrane proteins are more commonly obtained

    • Absence of endotoxins simplifies downstream purification

    • Native-like membrane environment may enhance proper folding of bacterial membrane proteins

These advantages make L. lactis particularly suitable for studies of bacterial membrane proteins like ybdJ, especially when structural and functional integrity is crucial for downstream applications.

What strategies can overcome low expression yields of recombinant UPF0177 protein ybdJ?

Low expression of membrane proteins is a common challenge that can be addressed through several optimization strategies:

  • Expression System Modifications:

    • Test different promoter strengths and induction conditions

    • Optimize ribosome binding sites for translation efficiency

    • Consider codon optimization for L. lactis expression

    • Evaluate expression at lower temperatures (20-25°C) to improve folding

  • Growth Condition Optimization:

    • Adjust media composition to support membrane protein production

    • Implement fed-batch cultures to maintain optimal growth rates

    • For pH-regulated systems, carefully control buffer composition

    • Monitor growth rates - significantly slower growth may indicate toxicity issues

  • Protein Engineering Approaches:

    • Test different affinity tags and their positions (N- vs C-terminal)

    • Consider fusion partners that may enhance folding and stability

    • Create truncated versions if specific domains cause expression difficulties

  • Detection Method Enhancement:

    • Use highly sensitive detection methods (Western blotting with enhanced chemiluminescence)

    • Implement epitope tags with high-affinity antibodies

    • Optimize membrane protein extraction with different detergents before analysis

Research on other membrane proteins in L. lactis has shown that overexpression can significantly impact growth, requiring approximately 4 additional hours to reach similar biomass as control strains . This suggests that carefully balancing expression levels against cellular health is critical for optimal protein production.

How can researchers improve the solubility and stability of UPF0177 protein ybdJ?

Membrane proteins present unique challenges for solubility and stability. These approaches can help:

  • Extraction Optimization:

    • Systematic screening of detergents (start with DDM, LMNG, and CHAPS)

    • Include lipids during solubilization (0.1-0.5 mg/ml of POPC or E. coli lipid extract)

    • Optimize detergent:protein ratio and solubilization time

    • Consider newer solubilization methods such as SMALPs (styrene-maleic acid lipid particles)

  • Buffer Optimization:

    • Test different pH values around physiological range (pH 6.5-8.0)

    • Evaluate various salt concentrations (typically 100-500 mM NaCl)

    • Add stabilizing agents (10-20% glycerol, 1-5 mM EDTA, 5 mM β-mercaptoethanol)

    • Include specific lipids in purification buffers

  • Protein Engineering:

    • Identify and remove flexible regions that may promote aggregation

    • Introduce thermostabilizing mutations based on homology modeling

    • Consider fusion with solubility-enhancing partners if function permits

  • Storage Conditions:

    • Determine optimal storage temperature (-80°C typically best for membrane proteins)

    • Test cryoprotectants (glycerol, sucrose) at various concentrations

    • Evaluate stability during freeze-thaw cycles

    • Consider lyophilization protocols for long-term storage

Optimizing these conditions is typically an iterative process requiring systematic testing and analysis of protein quality after each modification to the protocol.

How can structural biology techniques be applied to UPF0177 protein ybdJ?

Structural characterization of membrane proteins requires specialized approaches:

  • X-ray Crystallography:

    • Requires detergent-solubilized, highly purified, and stable protein

    • Lipidic cubic phase crystallization often more successful for membrane proteins

    • Crystallization chaperones (antibody fragments, nanobodies) may facilitate crystal formation

  • Cryo-Electron Microscopy:

    • Increasingly powerful for membrane protein structure determination

    • Can work with smaller amounts of protein than crystallography

    • Various membrane mimetics can be employed (nanodiscs, amphipols)

  • NMR Spectroscopy:

    • Solution NMR for smaller membrane proteins or domains

    • Solid-state NMR for proteins in native-like lipid environments

    • Can provide dynamic information not available from static structures

  • Complementary Approaches:

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • EPR spectroscopy with site-directed spin labeling for distance measurements

    • Cross-linking mass spectrometry to determine proximity relationships

The choice of method depends on protein size, stability, and the specific structural questions being addressed. Often, integrating multiple approaches provides the most comprehensive structural understanding.

What is known about the evolution and conservation of UPF0177 family proteins across bacterial species?

Evolutionary analysis of UPF0177 family proteins can provide insights into their functional importance:

  • Phylogenetic Distribution:

    • UPF0177 family proteins appear conserved across various Gram-positive bacteria

    • Particularly common in lactic acid bacteria, suggesting potential roles in fermentative metabolism

    • Varying levels of conservation correlate with evolutionary distance between species

  • Sequence Conservation Patterns:

    • Transmembrane domains typically show higher conservation than loop regions

    • Certain motifs may be invariant across species, suggesting critical functional roles

    • Conservation analysis can identify key residues for mutagenesis studies

  • Genomic Context:

    • Analysis of neighboring genes may reveal functional associations

    • Operon structures containing ybdJ homologs could suggest participation in specific pathways

    • Horizontal gene transfer patterns might indicate selective advantages

  • Structural Homology:

    • Despite sequence divergence, structural motifs may be preserved

    • Distant homologs with known functions could provide clues to ybdJ function

    • Comparison with membrane proteins of known function may reveal similarities

Understanding the evolutionary context of ybdJ can guide hypothesis generation about its function and identify the most promising experimental approaches for its characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.