Recombinant Lactococcus lactis subsp. lactis UPF0177 protein yxdF (yxdF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yxdF; LL2251; L122569; UPF0177 protein YxdF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Target Names
yxdF
Target Protein Sequence
MTLVLILIFIIAWKLGYLKNTLKNWDLKRIFWLMGIVFFTLATNYLVTVLVLKTQIISSV TSDTGMSDILGQLPILCQKYILGIIVPLSEELLFRSYIFGSITNKKVAFLISSVLFALVH TGFSWYLLPYLILSFIITWVYSKRNNFIESAIVHSSVNLFGGSAIKLLDTFFKLLPY
Uniprot No.

Target Background

Database Links

KEGG: lla:L122569

STRING: 272623.L122569

Protein Families
UPF0177 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for the recombinant UPF0177 protein yxdF?

The recombinant UPF0177 protein yxdF should be stored in a Tris-based buffer containing 50% glycerol that has been optimized specifically for this protein . For short-term storage, working aliquots can be maintained at 4°C for up to one week . For long-term preservation, the protein should be stored at -20°C, and for extended storage periods, it is recommended to conserve the protein at either -20°C or -80°C . It is important to note that repeated freezing and thawing cycles should be avoided to maintain protein integrity and activity, making it advisable to prepare single-use aliquots when first receiving the protein .

Why is Lactococcus lactis being used as an expression system for recombinant proteins?

Lactococcus lactis has emerged as an excellent alternative to Escherichia coli for recombinant protein production for several important reasons. First, L. lactis is classified as a Generally Recognized As Safe (GRAS) organism, making it suitable for producing proteins for biomedical applications . Unlike E. coli, L. lactis does not produce endotoxins (lipopolysaccharides or LPS), resulting in safer therapeutic proteins . Additionally, L. lactis generally demonstrates higher recombinant protein solubility compared to E. coli, which is particularly beneficial for aggregation-prone proteins . The downstream processing of proteins produced in this Gram-positive bacterium is also typically more straightforward than with Gram-negative hosts . Moreover, L. lactis has versatile genetic tools available, including three well-developed gene expression systems: NICE (nisin-controlled expression system), P170, and zinc systems .

How does growth condition affect the quality and solubility of recombinant proteins in L. lactis?

The metabolic regime and cultivation conditions significantly impact both protein quality and solubility in Lactococcus lactis . Research has demonstrated that anaerobic growth (fermentative metabolism) provides optimal conditions for recombinant protein production in L. lactis . In comparative studies, proteins produced under fermentative metabolism showed higher solubility and better conformational quality than those produced under respiratory conditions (when hemin is added to aerated cultures) . These differences are likely related to the cellular stress responses and folding machinery activity under different metabolic states. For researchers seeking to optimize recombinant protein production in L. lactis, establishing anaerobic growth conditions should be a primary consideration to maximize both yield and quality of the target protein .

What factors influence the conformational quality of recombinant proteins in L. lactis?

Multiple factors have been shown to influence the conformational quality of recombinant proteins in Lactococcus lactis:

FactorImpact on Protein QualityRecommended Conditions
Production timeLonger times generally increase fluorescence activity and solubility3+ hours post-induction
Growth temperatureSignificant impact on protein folding and solubilityOrganism-specific optimization required
Metabolic regimeAnaerobic (fermentative) conditions favor better conformational qualityFermentative growth without aeration
Culture media compositionCan affect protein expression levels and qualityNeeds optimization for specific proteins

Research using fluorescent proteins as conformational quality markers has established a positive linear relationship between proper protein folding and native-like conformations . Studies with aggregation-prone GFP variants have shown that protein solubility in L. lactis can reach up to 67% after 3 hours of production, which is substantially higher than the 10-18% solubility observed for the same protein in E. coli under comparable conditions . These findings highlight the superior folding environment provided by L. lactis for challenging proteins.

What are the key experimental controls when working with the UPF0177 protein yxdF?

When designing experiments involving the UPF0177 protein yxdF, several critical controls should be incorporated:

  • Expression vector-only control: Cells transformed with the expression vector lacking the yxdF insert to identify any background effects.

  • Inactive protein control: If studying functional aspects, a version with site-directed mutations in predicted active sites should be included.

  • Tag-only control: Since the recombinant protein may contain various tags (determined during the production process), a tag-only expression control helps distinguish tag-mediated effects .

  • Time-course sampling: Collecting samples at different post-induction timepoints (e.g., 1h, 3h, 5h) allows for monitoring protein accumulation and quality changes over time .

  • Growth condition controls: Parallel cultures grown under different conditions (aerobic vs. anaerobic) would provide insights into how metabolic state affects protein quality .

These controls ensure experimental rigor and allow for proper interpretation of results, particularly when investigating novel functions or interactions of the UPF0177 protein yxdF.

How should researchers optimize the expression of UPF0177 protein yxdF in L. lactis?

Optimization of UPF0177 protein yxdF expression in L. lactis should follow a systematic approach:

  • Promoter selection: Evaluate multiple expression systems (NICE, P170, or zinc-inducible) to determine which provides optimal expression levels without toxicity .

  • Induction conditions: For inducible systems, test different inducer concentrations and induction timing relative to growth phase.

  • Growth media optimization: Basic media formulations may need adjustment of carbon sources, nitrogen content, or mineral supplementation.

  • Temperature regulation: Growth temperature plays a crucial role in protein solubility and conformational quality; test a range (20-37°C) to identify optimal conditions .

  • Establish anaerobic conditions: Given that fermentative metabolism favors protein quality, ensure proper anaerobic cultivation techniques .

  • Harvest timing: For UPF0177 protein yxdF, longer post-induction times (3+ hours) may increase the proportion of properly folded, soluble protein .

This systematic approach allows researchers to tailor expression conditions specifically to the characteristics of the UPF0177 protein yxdF, maximizing both yield and quality of the recombinant protein.

What structural features characterize the UPF0177 protein yxdF?

The UPF0177 protein yxdF is characterized by several structural features that can be inferred from its amino acid sequence:

  • Transmembrane domains: The sequence suggests the presence of hydrophobic regions consistent with membrane-spanning segments, particularly in the N-terminal portion (amino acids MTLVLILIFIIAWKLGYLK) .

  • Hydrophobic core: The protein contains several hydrophobic amino acid stretches, suggesting it may be membrane-associated or have internal hydrophobic pockets.

  • Potential functional domains: While the UPF (Uncharacterized Protein Family) designation indicates limited functional knowledge, sequence analysis reveals potential binding sites and interaction motifs.

  • Expression region: The expression region encompasses amino acids 1-177, representing the full-length protein .

Researchers studying this protein should consider these structural features when designing experiments, particularly for solubilization strategies, functional assays, and interaction studies.

What methods are recommended for assessing the quality and functionality of recombinant UPF0177 protein yxdF?

The quality and functionality of recombinant UPF0177 protein yxdF can be assessed using multiple complementary approaches:

  • Solubility analysis: Determine the ratio of soluble versus insoluble protein using centrifugation-based fractionation followed by Western blot analysis .

  • Conformational integrity assessment: Although UPF0177 protein itself lacks intrinsic fluorescence, fusion with fluorescent proteins (like GFP) can enable real-time monitoring of folding quality .

  • Circular dichroism (CD) spectroscopy: Useful for analyzing secondary structure elements and conformational changes under different conditions.

  • Size-exclusion chromatography: Evaluate the oligomeric state and detect potential aggregation.

  • Thermal shift assays: Measure protein stability and identify stabilizing buffer conditions.

  • Mass spectrometry: Confirm protein identity, assess post-translational modifications, and verify sequence integrity.

These analytical methods provide comprehensive characterization of the recombinant protein's quality, which is essential for downstream functional studies and applications.

How does the production of UPF0177 protein yxdF in L. lactis compare to production in E. coli?

The production of UPF0177 protein yxdF and similar recombinant proteins shows significant differences between Lactococcus lactis and Escherichia coli expression systems:

ParameterL. lactisE. coliImplications
Protein solubilityUp to 67% for aggregation-prone proteins10-18% for the same proteinsL. lactis provides superior folding environment
Endotoxin contentNone (LPS-free)Contains lipopolysaccharidesL. lactis-produced proteins are safer for biomedical applications
Downstream processingSimplified due to Gram-positive cell wallMore complex due to endotoxin removal requirementsReduced purification steps with L. lactis
Stress response impactLess severe conformational stress responseSevere bottlenecks due to stress responsesBetter protein quality with L. lactis
Disulfide bond formationMore favorable conditionsOften requires engineered strainsImportant for structural integrity of many proteins

These differences highlight why L. lactis has emerged as an attractive alternative for producing challenging proteins like UPF0177 protein yxdF, particularly for biomedical applications where protein quality and purity are paramount .

What strategies can be employed to enhance the functional yield of UPF0177 protein yxdF?

Several evidence-based strategies can enhance the functional yield of UPF0177 protein yxdF in expression systems:

  • Metabolic manipulation: Establish anaerobic growth conditions to promote fermentative metabolism in L. lactis, which has been demonstrated to enhance protein solubility and conformational quality .

  • Temperature optimization: Lower growth temperatures often improve protein folding by slowing translation rate, allowing more time for proper folding .

  • Co-expression of chaperones: Introducing molecular chaperones can assist proper protein folding and prevent aggregation.

  • Fusion tags selection: Testing different solubility-enhancing tags (e.g., MBP, SUMO, GST) can significantly improve soluble expression.

  • Codon optimization: Adjusting the coding sequence to match the codon bias of L. lactis can improve translation efficiency.

  • Post-induction harvest timing: Longer production times after induction (3+ hours) have been shown to increase the proportion of soluble, properly folded protein in L. lactis .

Implementation of these strategies requires systematic optimization, but can substantially improve both the yield and quality of the recombinant UPF0177 protein yxdF, enabling more productive research applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.