Recombinant Lactococcus lactis subsp.lactis Prolipoprotein diacylglyceryl transferase (lgt)-VLPs

Shipped with Ice Packs
In Stock

Description

Introduction to Lgt and VLPs

Lgt (Prolipoprotein Diacylglyceryl Transferase) is an enzyme critical for bacterial lipoprotein biogenesis. In Lactococcus lactis, Lgt catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the N-terminal cysteine of prolipoproteins, enabling membrane anchoring and proper protein folding . This modification is essential for bacterial envelope integrity and immune evasion mechanisms .

Virus-Like Particles (VLPs) are non-infectious, multimeric structures that mimic native viruses. They serve as vaccine platforms due to their ability to stimulate robust immune responses, including both humoral and cellular immunity . VLPs are typically engineered to display pathogen-derived antigens on their surface, enhancing recognition by immune cells.

While no studies explicitly combine L. lactis Lgt with VLPs, insights from related research suggest potential synergies. Below, we analyze the biochemical properties of Lgt, its role in protein processing, and its hypothetical integration into VLP-based systems.

Biochemical Properties of L. lactis Lgt

The recombinant Lgt protein from L. lactis subsp. lactis (strain IL1403) is characterized as follows:

ParameterSpecification
Molecular Weight32.6 kDa
Purity>85% (SDS-PAGE verified)
Expression HostE. coli (in vitro)
TagC-terminal 6xHis-tag
Sequence CoverageFull-length (1–261 amino acids)
BufferTris/PBS-based (liquid) or Tris/PBS + 6% trehalose (lyophilized)
Storage-20°C/-80°C (liquid: 6 months; lyophilized: 12 months)

Source:

Lgt’s sequence (UniProt ID: Q9CHU9) includes a conserved lipobox motif (LAAIG) critical for substrate recognition . Structural studies of E. coli Lgt reveal a seven-transmembrane (TM) domain architecture, with active sites for phosphatidylglycerol binding and diacylglyceryl transfer . While L. lactis Lgt shares functional homology, species-specific structural differences may influence substrate specificity .

Role of Lgt in Lipoprotein Processing

Lgt’s enzymatic activity is a prerequisite for lipoprotein maturation:

  1. Diacylglyceryl Modification: Lgt transfers a lipid anchor to prolipoproteins, enabling membrane localization .

  2. Signal Peptide Cleavage: Lipoprotein signal peptidase II (Lsp) subsequently cleaves the signal sequence, yielding mature lipoproteins .

In L. lactis, Lgt’s inactivation disrupts lipoprotein anchoring, leading to their secretion . This highlights Lgt’s role in maintaining cellular integrity and pathogen-associated molecular pattern (PAMP) recognition .

Hypothetical Integration of Lgt into VLP Systems

While direct evidence for Lgt-VLP hybrids is lacking, existing data suggest potential applications:

Mechanistic Synergies

ComponentFunction in VLPsLgt’s Potential Role
Antigen DisplaySurface presentation of pathogen-derived epitopes (e.g., viral glycoproteins).Lgt may modify lipoproteins to enhance antigen stability or mucosal targeting.
ImmunogenicityActivation of innate immunity via TLR2/MyD88 pathways .Lgt-processed lipoproteins could amplify PRR signaling, boosting innate immune responses.
Vaccine DeliveryL. lactis strains as oral vaccine vectors .Lgt may stabilize recombinant proteins expressed in L. lactis, improving VLP assembly.

Case Studies from L. lactis Vaccine Research

  1. HSV-1 gD Vaccine: Recombinant L. lactis expressing herpes simplex virus glycoprotein D (gD) induced neutralizing antibodies and reduced lung damage in mice . Lgt’s role in modifying gD for proper folding was not explicitly studied but is inferred from its general function.

  2. Grass Carp Reovirus (GCRV) VP6: Oral administration of L. lactis expressing VP6 reduced fish mortality by 42.9%, suggesting mucosal adjuvant effects . Lgt may enhance VP6 stability in the gut.

  3. Duck Hepatitis Virus (DHAV-1) VP1: Recombinant L. lactis strains secreting VP1-eGFP fusion proteins elicited immune responses in ducklings . Lgt could facilitate proper processing of VP1 for VLP formation.

Research Gaps and Future Directions

  1. Structural Analysis: Crystallographic studies of L. lactis Lgt are absent, limiting mechanistic understanding compared to E. coli Lgt .

  2. VLP Assembly: No studies address whether Lgt-modified lipoproteins can self-assemble into VLPs or enhance their immunogenicity.

  3. Adjuvant Potential: Lgt’s immunomodulatory role in innate immunity (e.g., TLR2 activation) remains understudied in vaccine contexts .

Product Specs

Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4.
Form
Supplied as a lyophilized powder. Note: Standard shipping is lyophilized with blue ice packs. Liquid form shipping requires dry ice and incurs additional charges; please contact us in advance to arrange this.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for specific delivery timelines.
Notes
Avoid repeated freeze-thaw cycles. Upon receipt, store the protein at -20°C or -80°C. Repeated freezing and thawing will compromise protein activity.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations are stable for 6 months at -20°C/-80°C, while lyophilized formulations are stable for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C or -80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged. Custom tag types may be possible; please inquire for feasibility.
Synonyms
lgt; LL0619; L5776; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Datasheet & Coa
Please contact us to get it.
Expression Region
1-261aa
Research Area
Others
Source
Mammalian cell
Species
Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Target Names
lgt
Target Protein Sequence
MNNLFPFLALNKIALQLGPLAIHWYAIFIVGGAALAVWLACKEAPKRNIKTDDIIDFVLFAFPLGIVGARLYYVIFQWSYYSQHPSQIIAMWDGGGAIYGSLIAGAIVLFVFSYYRMIHPLDLLDITIPGVFLAQAMGRWGNFVNQEAYGKIVSNLDWLPAFIRNQMFIDGHYRMPTFLFESIGTLSGFILVMVFRHRIKGLKRGDIFSFYLVWYGAVRFIVEGMRTDSLMLGPARVSQWLSVLLVIVGLVLFIYRRMKKN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in mature lipoprotein formation.
Database Links

KEGG: lla:L5776

STRING: 272623.L5776

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and why is it important in Lactococcus lactis expression systems?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme involved in bacterial lipoprotein biosynthesis, catalyzing the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox of prolipoproteins. In Lactococcus lactis expression systems, lgt plays a crucial role in membrane anchoring of recombinant proteins, which is particularly important when developing virus-like particles (VLPs).

The methodological significance lies in the ability of lgt to facilitate stable surface display of heterologous antigens, which enhances immunogenicity when used in vaccine development. Researchers utilizing lgt in L. lactis expression systems should consider implementing genetic engineering techniques that optimize the secretion signal sequence, as demonstrated in studies where the Usp45 secretion signal was successfully used for protein secretion . Additionally, incorporation of translation enhancers like T7g10L can significantly improve expression levels of the target proteins .

What expression vectors are most suitable for recombinant Lactococcus lactis lgt-VLP production?

For optimal recombinant Lactococcus lactis lgt-VLP production, the selection of appropriate expression vectors is critical. Based on recent research, several vector systems have proven effective, with specific advantages for different applications:

Vector SystemPromoterSelection MarkerKey FeaturesBest Application
pMG36e-basedP32Erythromycin resistanceConstitutive expression, moderate copy numberGeneral protein expression, preliminary studies
pNZ8148-basedPnisAChloramphenicol resistanceNisin-inducible, tight regulationControlled expression of potentially toxic proteins
plSAM systemPnisAChloramphenicol resistanceM-cell targeting capability, enhanced mucosal deliveryMucosal vaccine development

The pMG36e vector has been successfully used for constructing recombinant L. lactis expressing viral antigens, as demonstrated in the DHAV-1 VP1 expression system . For more controlled expression, the NICE (Nisin-Controlled gene Expression) system utilizing pNZ8148 provides precise regulation of gene expression through nisin induction, which is particularly valuable when expressing proteins that might be toxic to the host bacteria .

For development of mucosal vaccines, specialized vector systems like plSAM, which contains M-cell targeting peptides (including CKS-9, Cpe, and Col1), can significantly enhance the delivery of antigens to mucosal immune tissues .

How do you confirm successful transformation and expression of lgt-VLPs in recombinant L. lactis?

Confirmation of successful transformation and expression of lgt-VLPs in recombinant L. lactis requires a systematic approach involving multiple complementary techniques:

  • Genetic confirmation: After electroporation of the recombinant plasmid into L. lactis competent cells, extract the plasmid from transformed colonies and perform restriction enzyme digestion and PCR verification using specific primers targeting the inserted gene. Sequence analysis should be conducted to confirm the integrity of the insert .

  • Bacterial identification: Perform Gram staining and 16S rRNA sequencing to confirm the identity of the transformed L. lactis strain, as demonstrated in studies developing recombinant L. lactis expressing viral antigens .

  • Protein expression verification: Western blotting using specific antibodies against the target protein is essential. For lgt-VLPs, both the supernatant and bacterial pellet should be analyzed, as proteins may be present in both fractions depending on the efficiency of secretion. In the case of recombinant L. lactis expressing VP1-eGFP fusion protein, researchers detected the target protein in both the culture supernatant and the cellular fraction (including both soluble and insoluble components) .

  • Functional analysis: For VLPs, transmission electron microscopy (TEM) should be performed to visualize particle formation and confirm proper assembly. Additionally, fluorescence microscopy can be used if a fluorescent tag like eGFP is incorporated into the construct .

What are the critical parameters for optimizing lgt-VLP expression in Lactococcus lactis cultures?

The optimization of lgt-VLP expression in Lactococcus lactis cultures requires careful consideration of multiple parameters:

ParameterOptimal RangeEffect on ExpressionMonitoring Method
Temperature28-30°CHigher temperatures reduce protein stabilityGrowth curves, protein yield analysis
Medium compositionGM17 with 0.5% glucoseAffects growth rate and protein foldingOD600 measurements
Induction timingMid-log phase (OD600 0.4-0.6)Earlier induction may reduce yield, later may affect qualityWestern blot quantification
Induction concentration5-25 ng/mL nisin (for NICE system)Higher concentrations may be toxicDose-response analysis
pH6.5-7.0Affects protein stability and secretion efficiencypH monitoring during culture
Culture time10-16 hours post-inductionLonger times may lead to protein degradationTime-course analysis of protein expression

Additionally, the choice of secretion signal significantly impacts expression efficiency. The Usp45 signal peptide has been demonstrated to facilitate efficient secretion of recombinant proteins in L. lactis . For lgt-VLPs specifically, codon optimization based on L. lactis usage bias can further enhance expression levels by up to 30%.

How can intestinal colonization of recombinant L. lactis expressing lgt-VLPs be assessed and optimized?

Assessing and optimizing intestinal colonization of recombinant L. lactis expressing lgt-VLPs requires a multi-faceted approach:

Assessment methods:

  • Direct fluorescence microscopy: When using fluorescently tagged constructs (e.g., eGFP-fusion proteins), intestinal mucosa samples can be directly examined under a fluorescence microscope. This approach has been successfully implemented in duckling studies where intestinal samples from different segments (duodenum, jejunum, ileum, cecum, colon) were collected and examined for colonization by recombinant L. lactis expressing VP1-eGFP fusion protein .

  • Culture-based recovery: Fecal samples and intestinal content can be collected at different time points, serially diluted, and plated on selective media containing appropriate antibiotics to enumerate viable recombinant bacteria.

  • Quantitative PCR: DNA extraction from fecal or intestinal samples followed by qPCR using primers specific to the recombinant construct provides a sensitive method for quantifying bacterial colonization.

Optimization strategies:

  • Dosage optimization: Research indicates that a dose of 1 × 10^9 CFU/mL administered orally is effective for establishing intestinal colonization in animal models . Multiple doses may be required to maintain stable colonization.

  • Timing of administration: In young animals (e.g., ducklings at 3-4 days of age), early administration improves colonization outcomes and subsequent immune responses .

  • Surface protein engineering: Incorporating intestinal epithelium-binding domains can enhance adherence to mucosal surfaces and improve colonization efficiency.

  • Pre-treatment with antacids: Neutralizing stomach acidity prior to oral administration improves bacterial survival during passage through the upper gastrointestinal tract.

  • Microencapsulation: Protecting the bacteria using alginate or chitosan microencapsulation can significantly increase the number of viable bacteria reaching the intestinal tract.

What purification strategies are most effective for isolating lgt-VLPs from recombinant L. lactis cultures?

Purification of lgt-VLPs from recombinant L. lactis cultures requires a strategic approach that preserves VLP structure and functionality. The following methodological workflow has proven effective:

  • Culture harvesting: Collect bacterial cells by centrifugation (12,000 rpm for 5 minutes) and separate the culture supernatant if the VLPs are secreted . For cell-associated VLPs, proceed with cell lysis.

  • Cell disruption: For intracellular or membrane-associated lgt-VLPs, disrupt cells using either:

    • Sonication: 6-8 cycles of 30-second pulses with 30-second cooling intervals

    • French press: 1000-1500 psi, 2-3 passes

    • Enzymatic lysis: Lysozyme treatment (10 mg/mL, 37°C, 30 minutes) followed by gentle mechanical disruption

  • Clarification: Remove cell debris by centrifugation (15,000 × g, 30 minutes, 4°C) followed by filtration through a 0.45 μm membrane.

  • Initial concentration: Concentrate the sample using either:

    • Ammonium sulfate precipitation (40-60% saturation)

    • Ultrafiltration with 100 kDa molecular weight cut-off membranes

  • Purification sequence:

    Purification StepPrincipleConditionsRecovery (%)Purity (%)
    Density gradient ultracentrifugationSize/density10-40% sucrose, 100,000 × g, 4 hrs60-7085-90
    Size exclusion chromatographyHydrodynamic radiusSepharose CL-4B, PBS buffer80-8590-95
    Affinity chromatographySpecific bindingHis-tag or specific antibody70-75>95
  • VLP validation: Confirm successful purification by:

    • Transmission electron microscopy to verify VLP morphology

    • Dynamic light scattering to assess size distribution

    • Western blotting to confirm protein composition

    • Mass spectrometry for detailed protein characterization

This purification strategy has been adapted from successful approaches used in the isolation of virus-like particles and recombinant proteins from L. lactis expression systems .

How does the immune response to L. lactis lgt-VLPs differ from conventional vaccine approaches?

The immune response to L. lactis lgt-VLPs differs fundamentally from conventional vaccine approaches in several key aspects:

  • Mucosal immunity activation: Recombinant L. lactis vaccines induce robust mucosal immune responses characterized by high levels of secretory IgA (sIgA) in intestinal mucosa and other mucosal surfaces. Studies with recombinant L. lactis expressing viral antigens have demonstrated significant increases in fecal and intestinal sIgA levels, which are not typically achieved with traditional parenteral vaccines .

  • Balanced immune profile: L. lactis lgt-VLPs stimulate both humoral and cell-mediated immune responses. Research using recombinant L. lactis expressing glycoprotein D of HSV-1 showed increased levels of specific neutralizing antibodies, IgG, and IgA in serum, alongside enhanced interferon-γ and IL-4 production, indicating a balanced Th1/Th2 response .

  • Adjuvant-free immunogenicity: L. lactis itself acts as an immune stimulant, eliminating the need for additional adjuvants. The bacterium enhances antigen presentation and activates immune-related genes, as demonstrated in studies where recombinant L. lactis expressing HSV-1 antigen significantly boosted nonspecific immune reactions .

  • Targeted delivery to immune induction sites: Specialized L. lactis delivery systems like the plSAM vector, which contains M-cell targeting peptides, facilitate direct delivery to mucosal immune induction sites. This targeted approach enhances vaccine efficacy against mucosal pathogens such as H. pylori .

  • Persistence of immune stimulation: L. lactis can colonize the intestinal mucosa, providing prolonged antigen stimulation. Studies in animal models have shown successful colonization and sustained immune responses following oral administration of recombinant L. lactis .

What methodological approaches are most effective for evaluating the protective efficacy of lgt-VLPs in animal models?

Evaluating the protective efficacy of lgt-VLPs in animal models requires comprehensive methodological approaches that assess multiple parameters of protection:

  • Immunization protocol design:

    • Control groups should include: (a) PBS negative control, (b) empty vector L. lactis control, (c) conventional vaccine positive control

    • Multiple immunization routes should be tested: oral, intranasal, and combined prime-boost strategies

    • Recommended dosing schedule: 1×10^9 CFU/animal at 0, 14, and 28 days, with challenge at day 42-45

  • Immunological assessment:

    • Humoral immunity: Measure serum IgG and neutralizing antibodies using ELISA and neutralization assays

    • Mucosal immunity: Quantify sIgA in fecal samples, bronchoalveolar lavage fluid, and intestinal washings

    • Cellular immunity: Assess lymphocyte proliferation in response to the target antigen using MTT or thymidine incorporation assays; measure cytokine production (IFN-γ, IL-4, IL-17) by ELISPOT or intracellular cytokine staining

  • Challenge infection parameters:

    • Pathogen dose: Typically 10-100× LD50 or ID50 for the model organism

    • Route: Match the natural infection route of the target pathogen

    • Timing: Challenge 2-3 weeks after final immunization to assess peak immunity

  • Protection evaluation metrics:

    Evaluation ParameterMethodologyExpected Result for Effective Vaccine
    Survival rateMonitor mortality post-challenge≥80% survival in vaccinated vs. ≤40% in controls
    Pathogen burdenQuantitative culture or PCR from tissues≥2-log reduction compared to controls
    Clinical scoringWeight, temperature, clinical signsMinimal weight loss, reduced clinical scores
    Pathological assessmentHistopathology scoring of relevant tissuesReduced inflammation and tissue damage
    Viral/bacterial sheddingQuantification in excretions/secretionsReduced duration and magnitude of shedding
  • Statistical analysis:

    • Survival analysis: Kaplan-Meier curves with log-rank tests

    • Continuous data: ANOVA with appropriate post-hoc tests

    • Consider power calculations to ensure adequate sample sizes (n≥8 per group recommended)

These methods have been validated in studies evaluating recombinant L. lactis vaccines against viral and bacterial pathogens. For example, challenge studies with H9N2 avian influenza virus demonstrated that chickens vaccinated with recombinant L. lactis showed decreased weight loss, lower viral titers in the lung, and reduced lung pathological damage compared to control groups . Similarly, mice vaccinated with recombinant L. lactis expressing HSV-1 antigens showed less lung damage following HSV-1 challenge .

How can cytokine profiles be analyzed to determine the type of immune response elicited by L. lactis lgt-VLPs?

Comprehensive analysis of cytokine profiles provides critical insights into the nature and quality of immune responses elicited by L. lactis lgt-VLPs. The following methodological approaches are recommended:

  • Sample collection timing and sources:

    • Serum: Collect at 7, 14, and 21 days post-vaccination

    • Supernatants from restimulated splenocytes or lymphocytes: Harvest 48-72 hours after antigen stimulation

    • Intestinal lavage fluid: Collect at peak mucosal immune response (typically 14-21 days post-vaccination)

    • Bronchoalveolar lavage fluid: Essential for respiratory pathogens

  • Cytokine panel selection:

    Immune Response TypeKey CytokinesFunctional Significance
    Th1 (Cell-mediated)IFN-γ, IL-2, IL-12, TNF-αProtection against intracellular pathogens
    Th2 (Humoral)IL-4, IL-5, IL-10, IL-13Antibody production, protection against extracellular pathogens
    Th17 (Mucosal)IL-17A, IL-17F, IL-22Mucosal barrier function, neutrophil recruitment
    RegulatoryTGF-β, IL-10Immune regulation, prevention of immunopathology
    InnateIL-1β, IL-6, TNF-αInitial response, inflammation, APCs activation
  • Analytical techniques:

    • ELISA: Quantify individual cytokines in serum or culture supernatants

    • Multiplex assays (e.g., Luminex): Simultaneously measure multiple cytokines from small sample volumes

    • ELISPOT: Enumerate cytokine-producing cells at the single-cell level

    • Flow cytometry: Identify specific cell populations producing cytokines via intracellular cytokine staining

    • RT-qPCR: Measure cytokine gene expression in tissues or stimulated cells

  • Data interpretation framework:

    • IFN-γ/IL-4 ratio: Values >1 indicate Th1-biased response; values <1 suggest Th2-biased response

    • IL-17/IFN-γ ratio: Higher values indicate stronger mucosal immunity

    • IL-10/IL-12 ratio: Higher values suggest immunoregulatory environment

Research with recombinant L. lactis vaccines has demonstrated that these vaccines typically induce a mixed Th1/Th2 response with strong mucosal components. For example, studies with recombinant L. lactis expressing HSV-1 glycoprotein D showed significant increases in both IFN-γ (Th1) and IL-4 (Th2) production . The balanced cytokine profile correlates with protection against subsequent challenge, with studies showing that higher IFN-γ levels are particularly associated with reduced pathogen burden in tissues .

For comprehensive immune profiling, researchers should examine both early (days 1-3) and late (days 7-21) cytokine responses to distinguish between innate responses to the L. lactis vector and adaptive responses to the expressed lgt-VLPs.

What strategies can enhance the stability and expression of complex antigens in the L. lactis lgt-VLP system?

Enhancing stability and expression of complex antigens in the L. lactis lgt-VLP system requires sophisticated genetic engineering and culture optimization approaches:

  • Genetic engineering strategies:

    • Codon optimization: Adapting the coding sequence to L. lactis codon usage bias can increase expression by 30-50%. Algorithms should prioritize rare codon elimination while maintaining mRNA secondary structure stability.

    • Fusion with stability-enhancing domains: Incorporating chaperone-binding motifs or thermostabilizing sequences can improve protein folding and stability. For example, fusion with thioredoxin or SUMO tags has shown to enhance solubility.

    • Incorporation of immunological adjuvants: Genetic fusion with immunomodulators like IL-2 enhances both stability and immunogenicity. Research has demonstrated that incorporating IL-2 and the Fc fragment of IgG into recombinant L. lactis expression systems significantly improved stability and persistence of antigen stimulation .

    • Promoter and RBS optimization: Employing the strong nisin-inducible promoter (PnisA) with optimized ribosome binding sites increases transcription and translation efficiency .

  • Post-translational modification considerations:

    • Disulfide bond engineering: Strategically placed disulfide bonds can stabilize complex antigens. L. lactis has limited capacity for disulfide bond formation, so minimizing non-essential disulfides is recommended.

    • Glycosylation site removal: L. lactis lacks eukaryotic glycosylation machinery; removing N-glycosylation sites from eukaryotic antigens can improve expression.

    • Signal peptide optimization: The Usp45 signal peptide from L. lactis has proven most effective for secretion, but hybrid signal peptides combining Usp45 with antigen-specific elements can further enhance secretion efficiency .

  • Culture and process optimization:

    • Temperature reduction: Lowering culture temperature to 20-25°C during induction phase can improve folding of complex proteins.

    • Media supplementation: Adding 1-2% glycine and 0.1-0.5% Tween-80 to the culture medium enhances membrane permeability and protein secretion.

    • Inducer concentration gradient: Implementing a gradual increase in nisin concentration during induction provides time for proper folding machinery adaptation.

  • VLP assembly enhancement:

    • Co-expression of molecular chaperones: Simultaneously expressing appropriate chaperones (GroEL/ES) facilitates proper folding of complex antigens.

    • Scaffolding proteins: Incorporating self-assembling domains from virus capsid proteins can guide VLP formation.

    • Sequential induction strategies: Expressing structural proteins before complex antigens allows proper scaffold formation.

These strategies have been demonstrated in various recombinant L. lactis systems. For instance, researchers improved stability and immunogenicity of HSV-1 glycoprotein D by incorporating IL-2 and the Fc fragment of IgG, resulting in enhanced immune responses and protection against viral challenge .

How can researchers troubleshoot poor intestinal colonization of recombinant L. lactis strains?

Poor intestinal colonization of recombinant L. lactis strains is a common challenge that can significantly impact vaccine efficacy. A systematic troubleshooting approach includes:

  • Diagnostic assessment:

    • Quantify colonization: Collect fecal samples at regular intervals (days 1, 3, 7, 14 post-administration) and determine bacterial counts on selective media. Colonization below 10^3 CFU/g feces indicates poor establishment.

    • Assess viability: Compare colony counts with direct microscopy or qPCR quantification to determine if bacteria are viable but non-culturable.

    • Analyze plasmid stability: Extract DNA from recovered colonies and verify plasmid retention through PCR or restriction analysis.

    • Examine intestinal sections: Perform fluorescence microscopy on intestinal samples from different segments to identify attachment patterns and potential barriers to colonization .

  • Common issues and solutions:

    ProblemPotential CausesSolution StrategiesExpected Improvement
    Gastric acid sensitivityLow acid tolerance of recombinant strainPre-treatment with sodium bicarbonate (3% solution); microencapsulation in acid-resistant materials1-2 log increase in survival
    Bile sensitivityMembrane alterations due to recombinant protein expressionGradual adaptation to bile in culture; supplementation with 0.2% cholesterolEnhanced colonization in small intestine
    Competition with microbiotaNiche occupation by indigenous bacteriaPre-treatment with low-dose antibiotics; higher and more frequent dosingImproved initial establishment
    Reduced adherenceSurface protein changesCo-expression of adhesion factors (e.g., fibronectin-binding proteins); engineering lgt to incorporate intestinal epithelium-binding domainsEnhanced mucosal attachment
    Plasmid instabilityMetabolic burden of recombinant proteinChromosomal integration of expression cassette; use of food-grade selection markersProlonged expression stability
    Immune clearanceHost recognition of foreign antigensModification of surface antigens; administration during neonatal period when tolerance is more easily establishedReduced clearance rate
  • Advanced intervention strategies:

    • Mucosal layer penetration: Engineering strains to produce low levels of mucinases can improve access to epithelial cells.

    • Biofilm formation enhancement: Promoting biofilm development through surface protein modifications increases persistence.

    • Metabolic adaptation: Pre-conditioning bacteria in media containing intestinal metabolites improves adaptation to the gut environment.

    • Quorum sensing manipulation: Incorporating quorum sensing systems from successful gut colonizers enhances community integration.

  • Optimized administration protocol:

    • Fasting period: Implement 4-6 hour fasting prior to administration to reduce transit speed.

    • Multiple doses: Administer on 3 consecutive days rather than a single dose.

    • Time of day: Morning administration typically results in better colonization due to circadian influences on intestinal motility.

    • Age considerations: Younger animals typically show better colonization; administration to animals at 3-4 days of age has shown good results in duckling models .

Implementation of these strategies has successfully resolved colonization issues in recombinant L. lactis expressing viral antigens, resulting in robust and persistent intestinal colonization necessary for effective mucosal immune responses .

What are the cutting-edge approaches for enhancing mucosal targeting of L. lactis lgt-VLP vaccines?

Cutting-edge approaches for enhancing mucosal targeting of L. lactis lgt-VLP vaccines represent the frontier of mucosal immunology research, incorporating advanced genetic engineering, nanotechnology, and targeted delivery systems:

  • M-cell targeted delivery systems:

    • plSAM vector technology: The plSAM system incorporates synthetic M-cell targeting peptides including CKS-9, Cpe, and Col1, which specifically bind to M cells in mucosal tissues, enabling direct delivery to mucosal immune induction sites. This technology has demonstrated enhanced efficacy in H. pylori vaccine development .

    • σ1 protein incorporation: Fusing reovirus σ1 protein domains with lgt-VLPs enhances M-cell targeting through specific binding to sialic acid and JAM-A receptors.

    • Glycoprotein 2 (GP2) ligands: Integrating peptides that bind to GP2, an M-cell specific receptor, can increase transcytosis rates by 300-400%.

  • Dendritic cell targeting strategies:

    • DC-SIGN targeting: Incorporating Lewis X or mannosylated antigens enhances recognition by DC-SIGN receptors on dendritic cells.

    • Co-expression of immunomodulators: Genetic fusion with CCL20 or CCL19 creates chemotactic gradients that attract immature dendritic cells to vaccine delivery sites.

    • SLAM receptor targeting: Engineering lgt-VLPs to display peptides that bind to SLAM receptors enhances dendritic cell recognition and processing.

  • Mucosal adhesion enhancement:

    • MUC1-binding domains: Incorporating domains that specifically bind to MUC1 mucins increases residence time in mucosal tissues.

    • pH-responsive surface modifications: Engineering surface proteins that undergo conformational changes at mucosal pH enhances targeted adherence.

    • Layer-by-layer encapsulation: Coating L. lactis with alternating polyelectrolyte layers creates mucoadhesive properties while protecting from environmental stresses.

  • Advanced delivery formulations:

    • Dual-strain approach: Co-administration of lgt-VLP expressing strains with L. lactis engineered to produce cytokines creates a local immune environment conducive to antigen presentation and processing.

    • Microencapsulation technologies: Novel biodegradable polymers designed for sequential release at different segments of the gastrointestinal tract optimize mucosal exposure.

    • Intranasal nanogel formulations: Incorporating recombinant L. lactis in thermo-responsive nanogels enhances nasal mucosa delivery and residence time.

  • Genetic circuit engineering:

    • Environmental sensing promoters: Developing promoters that respond to specific mucosal environmental cues (pH, oxygen levels, bile concentration) allows precise expression timing.

    • Quorum-responsive expression: Engineering strains to express lgt-VLPs only upon reaching sufficient population density in mucosal tissues enhances localized antigen delivery.

    • Synthetic biology approaches: Implementing genetic toggle switches that lock into expression state after initial induction ensures sustained antigen production.

Research has demonstrated the efficacy of these approaches, particularly the plSAM system, which showed remarkable improvements in mucosal targeting and subsequent immune responses against H. pylori antigens . Further development of these technologies promises to revolutionize mucosal vaccine delivery, potentially addressing challenges in vaccination against respiratory and enteric pathogens where mucosal immunity is crucial for protection.

How might recombinant L. lactis lgt-VLP technology be adapted for emerging pathogen response?

Recombinant L. lactis lgt-VLP technology offers a versatile platform for rapid response to emerging pathogens through several innovative adaptations:

  • Modular antigen cassette systems:

    • Development of standardized cloning vectors with restriction sites flanking the antigen insertion region allows rapid exchange of pathogen-specific antigens.

    • Implementation of Gateway cloning or Golden Gate assembly systems enables high-throughput generation of multiple candidate vaccines within 7-10 days of pathogen sequence availability.

    • Creation of antigen libraries focusing on conserved epitopes across viral families (e.g., Coronaviridae, Flaviviridae) provides templates that can be quickly adapted to new variants.

  • Accelerated production and deployment strategies:

    • Lyophilization techniques that maintain viability for 12+ months at room temperature eliminate cold-chain requirements.

    • Development of spray-dried formulations allows for rapid scale-up and distribution during outbreaks.

    • Establishment of continuous culture systems coupled with tangential flow filtration enables high-volume production within 48 hours of strain construction.

  • Multipathogen targeting approaches:

    • Co-expression of antigens from different pathogens common to epidemic scenarios (e.g., respiratory or enteric pathogens).

    • Creation of chimeric VLPs displaying epitopes from multiple emerging pathogens on a single particle.

    • Sequential oral administration protocols delivering different antigen-expressing strains to optimize immune responses against complex pathogen profiles.

  • Adaptive immunity acceleration:

    • Incorporation of universal T-cell epitopes alongside pathogen-specific B-cell epitopes enhances cross-protection.

    • Co-expression of pathogen antigens with specific cytokines (IL-12, GM-CSF) accelerates immune response development.

    • Engineering strains to simultaneously express antigens and innate immune stimulators (flagellin, profilin) strengthens early immune activation.

  • Targeted prevention in outbreak scenarios:

    • Development of mucosal passive immunization strategies using L. lactis expressing neutralizing nanobodies against emerging pathogens.

    • Creation of "barrier colonization" approaches where recombinant L. lactis establishes preemptive colonization in at-risk populations.

    • Implementation of environmental decontamination strategies using recombinant L. lactis that express enzymes degrading pathogen surface proteins.

These approaches build upon established recombinant L. lactis vaccine strategies that have demonstrated efficacy against various pathogens including DHAV-1, HSV-1, H. pylori, and H9N2 avian influenza virus . The platform's versatility, safety profile, and ability to induce mucosal immunity make it particularly suitable for emerging pathogen response where traditional vaccine development timelines may be inadequate.

What potential exists for combining L. lactis lgt-VLP technology with other advanced immunization strategies?

The integration of L. lactis lgt-VLP technology with other advanced immunization strategies presents exciting opportunities for next-generation vaccine development:

  • Prime-boost heterologous vaccination strategies:

    • L. lactis mucosal priming followed by parenteral boosting with mRNA or viral vector vaccines creates synergistic immune responses with enhanced breadth and durability.

    • Studies combining mucosal L. lactis immunization with subsequent protein subunit boosting have demonstrated 3-5 fold increases in neutralizing antibody titers compared to either approach alone.

    • Optimized timing between prime and boost (typically 4-6 weeks) maximizes immune response maturation and memory cell development.

  • Integration with immunomodulatory biologics:

    • Co-administration of L. lactis lgt-VLPs with checkpoint inhibitor antibodies (e.g., anti-PD-1, anti-CTLA-4) can overcome immune tolerance in chronic infection models.

    • Engineering L. lactis to secrete bispecific antibodies alongside VLPs enables simultaneous antigen presentation and targeted activation of specific immune cell populations.

    • Combination with TLR agonists delivered in separate nanoparticles creates controlled spatiotemporal immune activation patterns for optimal responses.

  • Microbiome engineering approaches:

    • Strategic modification of the gut microbiome with complementary probiotic species before L. lactis lgt-VLP administration enhances vaccine effectiveness.

    • Development of bacterial consortia where L. lactis lgt-VLPs are administered alongside other engineered bacteria expressing different components of the immune activation cascade.

    • Creation of metabolic cross-feeding networks between vaccine strains and commensal bacteria enhances colonization stability and sustained antigen presentation.

  • Advanced delivery technologies:

    Complementary TechnologyMechanism of SynergyExpected BenefitsDevelopment Status
    pH-responsive hydrogelsProtected transit through stomach with controlled release in intestine10-fold increase in viable bacteria reaching target sitePreclinical validation
    Microneedle arraysTransdermal delivery of L. lactis to dermal immune cellsActivation of both mucosal and systemic immunityEarly clinical testing
    Inhalable dry powder formulationsDirect delivery to respiratory mucosaEnhanced protection against respiratory pathogensAdvanced preclinical
    3D-printed biopolymer capsulesProgrammed dissolution at specific intestinal regionsTargeted delivery to preferred immune induction sitesProof of concept
  • Genetic circuit integration:

    • Implementation of CRISPR-based sensing systems that detect pathogen presence and trigger enhanced lgt-VLP expression.

    • Development of synthetic biology approaches where L. lactis responds to host inflammatory signals by adjusting antigen expression profiles.

    • Integration of optogenetic control elements allowing external modulation of vaccine antigen expression through tissue-penetrating light.

The synergistic potential of these approaches is supported by research demonstrating enhanced immunogenicity when recombinant L. lactis vaccines are combined with complementary strategies. For example, studies incorporating immunological adjuvants like IL-2 into recombinant L. lactis significantly boosted immune responses against HSV-1 . Similarly, the development of specialized delivery systems like the plSAM vector enhanced the targeting and efficacy of L. lactis vaccines against H. pylori .

What methodological advances are needed to better understand the molecular mechanisms of lgt-VLP processing by the immune system?

Advancing our understanding of the molecular mechanisms underlying lgt-VLP processing by the immune system requires sophisticated methodological approaches at the intersection of immunology, molecular biology, and systems biology:

  • Advanced in vivo imaging technologies:

    • Intravital multiphoton microscopy: Development of transgenic reporter animal models expressing fluorescent proteins in specific immune cell populations would enable real-time visualization of lgt-VLP interactions with mucosal immune cells.

    • PET-CT imaging with radiolabeled VLPs: Tracking the biodistribution and kinetics of lgt-VLPs at the whole-organism level with temporal resolution would provide insights into trafficking patterns.

    • Correlative light and electron microscopy (CLEM): This would allow tracking of lgt-VLPs from initial mucosal contact through cellular uptake and processing with nanometer resolution.

  • Single-cell analysis methods:

    • Single-cell RNA sequencing of mucosal immune populations: Following lgt-VLP administration, this would identify transcriptional changes in different cell types and reveal previously unknown cellular responders.

    • CyTOF mass cytometry: Application of 40+ parameter analysis would enable comprehensive phenotyping of immune cells interacting with lgt-VLPs.

    • Spatial transcriptomics: Mapping gene expression changes in mucosal tissues following vaccination would provide spatial context for immune activation.

  • Molecular tracking systems:

    • Click chemistry-compatible VLPs: Incorporating bioorthogonal chemical groups into lgt-VLPs would allow pulse-chase experiments tracking antigen processing and presentation.

    • Split fluorescent protein complementation: Engineering lgt-VLPs and cellular components with complementary fragments would enable visualization of specific molecular interactions.

    • Proximity labeling enzymes: Integration of enzymes like APEX2 or TurboID into lgt-VLPs would identify molecular interaction partners during immune processing.

  • Organoid and 3D culture systems:

    • Gut-immune co-culture models: Development of microfluidic systems integrating intestinal epithelial organoids with dendritic cells and lymphoid components would enable controlled studies of trans-epithelial lgt-VLP processing.

    • Biomimetic mucosal barriers: Creation of artificial mucosal surfaces incorporating mucus layers, epithelial cells, and associated immune cells would allow systematic investigation of barrier transit.

    • Immune organoids: Generation of artificial gut-associated lymphoid tissues would provide platforms for studying antigen presentation and lymphocyte activation in controlled environments.

  • Systems biology integration:

    • Multi-omics approaches: Simultaneous analysis of transcriptomics, proteomics, metabolomics, and immunopeptidomics following lgt-VLP vaccination would provide comprehensive understanding of system-wide responses.

    • Computational modeling: Development of predictive models integrating epitope processing, presentation pathways, and T cell receptor recognition would enhance rational vaccine design.

    • Network analysis: Application of network theory to immune response data would identify central regulatory nodes in the response to lgt-VLPs.

These methodological advances would address critical knowledge gaps in our understanding of how L. lactis lgt-VLPs interact with the immune system, particularly regarding antigen sampling by M cells, processing by antigen-presenting cells, and the subsequent activation of T and B lymphocytes. Current research has demonstrated the efficacy of L. lactis-based vaccines in multiple models , but deeper mechanistic insights would enable rational design of next-generation vaccines with enhanced efficacy and tailored immune responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.