Recombinant Lactococcus phage r1t Holin

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Lactococcus phage r1t Holin is a bacterially expressed, His-tagged version of the holin protein encoded by the Lactococcus lactis bacteriophage r1t. This protein plays a critical role in phage-induced host cell lysis by forming pores in the cytoplasmic membrane, enabling endolysin access to the peptidoglycan layer . Its recombinant form is used extensively in structural and functional studies of phage lysis mechanisms.

Role in Phage Lysis

The r1t Holin (Orf48) operates in tandem with its cognate endolysin (Orf49) to execute host lysis:

  1. Pore Formation: Accumulates in the cytoplasmic membrane, forming lesions for endolysin translocation .

  2. Lysin Activation: Enables the amidase activity of Orf49 by facilitating its access to the peptidoglycan layer .

Mechanism of Action

FeatureCanonical Holin Pathway (e.g., λ S105)r1t Holin Pathway
Pore SizeMicron-scale lesionsSmaller, regulated pores
Timing RegulationDual-start translational controlNo alternative start codons observed
Endolysin ReleaseRequires large membrane holesAssisted by holin oligomerization
  • Cross-Kingdom Functionality: Unlike some holins, r1t Holin does not require species-specific factors, enabling functional studies in heterologous systems like E. coli .

Key Studies

  • Oligomerization Analysis: Cross-linking experiments confirmed r1t Holin’s ability to form dimers and higher-order oligomers in E. coli membranes .

  • Chaperone Interactions: Demonstrated functional parallels with Mycobacterium phage Ms6 Gp1, a holin-independent lysin chaperone .

  • Lysis Timing: Deletion studies in phage Ms6 showed holins fine-tune lysis timing, with implications for phage therapy .

Industrial Relevance

  • Phage Resistance Mitigation: Recombinant holins are used to study mechanisms of phage-host interactions in dairy fermentation .

  • Antimicrobial Development: Insights into holin-lysin systems inform engineered lysins for targeting antibiotic-resistant bacteria .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve oligomerization dynamics.

  • Synthetic Biology: Engineering holin variants with tunable pore sizes for controlled drug delivery .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Holin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-75
Protein Length
full length protein
Species
Lactococcus phage r1t (Bacteriophage r1t)
Target Protein Sequence
MKTFFKDMAERAIKTFAQAMIGALGAGATGLIGVDWLQALSIAGFATVVSILTSLASGIP GDNTASLVNNKKEGE
Uniprot No.

Target Background

Function
This protein accumulates harmlessly in the cytoplasmic membrane until it reaches a critical concentration. This triggers the formation of micron-scale pores (holes) leading to host cell membrane disruption. This allows the endolysin to escape into the periplasmic space. The precise timing of host cell lysis is determined by this protein. It works in conjunction with the endolysin protein in a sequential process that culminates in programmed host cell lysis, releasing mature viral particles from the host cell.
Database Links

KEGG: vg:955473

Subcellular Location
Host cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.