Recombinant Lactuca sativa ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant atpI is primarily produced via bacterial expression systems, though plant-based platforms are emerging as alternatives.

coli Expression and Purification

  • Expression: The atpI gene is cloned into a plasmid and expressed in E. coli. The His tag facilitates purification via nickel affinity chromatography .

  • Purification Steps:

    1. Cell Lysis: Chemical or mechanical disruption of E. coli cells.

    2. Centrifugation: Separation of soluble (cytoplasmic) and insoluble (membrane-associated) fractions .

    3. Affinity Chromatography: Binding of His-tagged atpI to nickel columns .

    4. Gel Filtration: Final polishing to achieve >95% purity .

Yield and Purity:

ParameterValueSource
Yield~1–2 mg/L bacterial culture (estimated)
Purity>95% (SDS-PAGE confirmed)

Plant-Based Expression Systems

While not yet widely adopted for atpI, transient expression in Lactuca sativa via agroinfiltration shows promise for scalable production . This method leverages Agrobacterium tumefaciens to deliver recombinant DNA into plant cells, enabling rapid protein synthesis without stable transformation.

Advantages of Plant Systems:

  • Post-Translational Modifications: Enables proper folding and membrane integration.

  • Scalability: Suitable for large-scale agricultural production .

Functional Roles in Plant Physiology

ATP synthase subunit a plays critical roles in energy metabolism and stress adaptation.

Proton Translocation and ATP Synthesis

Subunit a forms part of the proton channel in the Fo sector, working in coordination with subunit c to drive ATP synthesis. In chloroplasts, this process is coupled to the proton gradient generated by the photosynthetic electron transport chain .

Stress Response and Tolerance

Overexpression of ATP synthase subunits (e.g., atpI) in plants enhances tolerance to abiotic stresses:

  • Salt Stress: Increased ATP production supports ion homeostasis .

  • Drought: Stabilizes energy production under water-limiting conditions .

  • Oxidative Stress: Maintains redox balance in the chloroplast .

Case Study: In Arabidopsis thaliana, overexpression of mitochondrial ATP synthase subunits (AtMtATP6) improved salt and cold tolerance, suggesting conserved mechanisms across organelles .

Research Applications

Recombinant atpI is utilized in structural, biochemical, and biotechnological studies.

Biotechnological Uses

  • Enzyme Activity Assays: ATP synthase activity is measured via ATP hydrolysis or synthesis assays using purified Fo-F1 complexes .

  • Stress-Resistant Crops: Engineering plants with enhanced ATP synthase activity to mitigate climate-related yield losses .

Challenges and Future Directions

  • Low Yield in E. coli: Membrane proteins like atpI often misfold or aggregate in bacterial systems, necessitating optimization of expression conditions .

  • Plant-Based Scaling: Agroinfiltration and chloroplast transformation (e.g., using Chlamydomonas systems) could improve yield and functionality .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will fulfill it if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend consulting your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; PSC016; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Lactuca sativa (Garden lettuce)
Target Names
atpI
Target Protein Sequence
MNVLSCSINTLNGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLASATLAVRN PQTIPTSGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: lsv:3772794

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What expression systems are typically used for producing recombinant Lactuca sativa atpI?

The production of recombinant Lactuca sativa atpI typically employs Escherichia coli as the preferred expression system due to its well-established genetic manipulation tools, rapid growth, and high protein yield capabilities. The procedure generally involves the following methodological steps:

  • Gene cloning: The atpI gene sequence is PCR-amplified from Lactuca sativa chloroplast DNA, or alternatively, synthesized based on the known sequence with codon optimization for E. coli expression.

  • Vector construction: The gene is inserted into an expression vector containing a strong promoter (commonly T7), a His-tag sequence for purification purposes, and appropriate selection markers .

  • Transformation and expression: The recombinant vector is transformed into an E. coli expression strain, such as BL21(DE3), which contains an IPTG-inducible T7 RNA polymerase gene .

  • Culture and induction: The transformed bacteria are cultured to mid-log phase and protein expression is induced, typically using IPTG at concentrations between 0.1-1.0 mM. The optimal induction temperature is often lower than the growth temperature (e.g., 18-25°C) to enhance proper protein folding.

  • Harvest and purification: Cells are harvested by centrifugation, lysed (using methods such as sonication or chemical lysis), and the recombinant protein is purified using immobilized metal affinity chromatography (IMAC) based on the His-tag affinity .

The purified protein is typically stored in a Tris-based buffer containing 50% glycerol at -20°C for short-term storage or -80°C for long-term storage . To preserve activity, it is recommended to store working aliquots at 4°C for up to one week, as repeated freeze-thaw cycles can compromise protein integrity and function .

How is the purity and integrity of recombinant atpI protein verified?

The purity and integrity of recombinant Lactuca sativa atpI protein are verified through a combination of analytical techniques that assess both the physical and functional properties of the protein. A comprehensive verification approach includes the following methodological steps:

  • SDS-PAGE analysis: This is the primary method for evaluating protein purity, with recombinant atpI preparations typically showing >90% purity on Coomassie-stained gels . The protein should migrate at approximately 25-28 kDa, consistent with its predicted molecular weight including any fusion tags.

  • Western blotting: Using antibodies specific to either the atpI protein or the fusion tag (commonly His-tag), Western blotting confirms the identity of the purified protein and detects any degradation products.

  • Mass spectrometry: MALDI-TOF or LC-MS/MS analysis provides precise molecular weight confirmation and can verify the protein sequence through peptide mapping. This is particularly important for confirming post-translational modifications or cleavage of fusion tags.

  • Circular dichroism (CD) spectroscopy: This technique assesses the secondary structure of the protein, providing information about proper folding. For membrane proteins like atpI, this can be performed in the presence of detergent micelles or liposomes to mimic the native membrane environment.

  • Functional assays: ATP synthase activity can be measured using reconstitution assays where the purified atpI is incorporated into liposomes containing other ATP synthase subunits. ATP synthesis or hydrolysis rates can then be monitored using techniques such as luciferase-based ATP detection or coupled enzyme assays.

  • Thermostability assessment: Differential scanning calorimetry or thermal shift assays can evaluate the protein's thermal stability, which correlates with proper folding and functional integrity.

For research purposes, it is recommended to perform multiple verification steps rather than relying on a single technique, as each method provides complementary information about different aspects of protein quality .

What are the optimal conditions for reconstituting functional chloroplast ATP synthase using recombinant atpI?

Reconstituting functional chloroplast ATP synthase using recombinant atpI requires precise conditions to achieve proper assembly and activity. The following methodological approach has been optimized based on recent research findings:

  • Preparation of lipid bilayers: A mixture of phosphatidylcholine, phosphatidylethanolamine, and phosphatidylglycerol (4:3:3 ratio) most closely mimics the thylakoid membrane composition. These lipids should be dissolved in chloroform, dried under nitrogen, and rehydrated in reconstitution buffer (typically 20 mM MOPS, pH 7.0, 50 mM NaCl).

  • Protein preparation: Recombinant atpI should be solubilized in a mild detergent such as n-dodecyl-β-D-maltoside (DDM) at a concentration of 0.05-0.1%, which maintains protein stability while facilitating incorporation into lipid bilayers .

  • Co-reconstitution with other subunits: For complete ATP synthase assembly, purified subunits from the F1 complex (α3β3γδε) and the remaining F0 components (b, b', c-ring) must be added in the appropriate stoichiometric ratios. Research has shown that the assembly process is sequential, with the c-ring and a-subunit (atpI) forming an initial complex, followed by association with the b/b' stalk and subsequent docking of the F1 portion .

  • Detergent removal: The detergent is gradually removed using Bio-Beads or through dialysis against detergent-free buffer containing 5 mM MgCl2, which stabilizes subunit interactions.

  • Verification of assembly: Blue-native PAGE, electron microscopy, and functional assays should be used to confirm proper complex formation.

  • Optimizing activity conditions: The reconstituted complex shows optimal activity at pH 8.0 with 10 mM MgCl2 and 50 mM KCl. ATP synthesis activity can be measured by creating an artificial proton gradient using acid-base transition or valinomycin-induced K+ diffusion potential.

Research has shown that the presence of the chloroplast-specific factor PAB (PROTEIN IN CHLOROPLAST ATPASE BIOGENESIS) significantly enhances the assembly efficiency by assisting with the proper incorporation of the γ-subunit into the complex . Additionally, the BIOGENESIS FACTOR REQUIRED FOR ATP SYNTHASE 1 (BFA1) acts as a scaffold protein coordinating the early steps of the CF1 assembly by mediating interactions between α, β, and γ subunits .

How does the structure-function relationship of atpI contribute to proton translocation in chloroplast ATP synthase?

The structure-function relationship of atpI in chloroplast ATP synthase reveals sophisticated molecular mechanisms for proton translocation that drive ATP synthesis. Current research demonstrates several key aspects of this relationship:

  • Transmembrane topology: The atpI subunit contains five to six transmembrane helices that span the thylakoid membrane, creating part of the proton channel at the interface with the c-ring . These transmembrane segments are arranged to form a half-channel structure that guides protons from the lumenal side of the membrane to the critical Arg residue at the a/c subunit interface.

  • Critical residues for proton conductance: Structure-function studies have identified several conserved charged residues within atpI that are essential for proton translocation:

    ResiduePositionFunction
    Arg210*TM4Forms salt bridge with cAsp61, essential for proton transfer
    Glu219*TM5Contributes to proton path from lumen
    His245*C-terminusFacilitates proton entry from stromal side
    Asn142TM2-TM3 loopStabilizes channel conformation

    *Positions are approximate based on homology with other species and may vary slightly in Lactuca sativa

  • Mechanism of proton translocation: The current model proposes that protons enter the half-channel from the lumenal side of the membrane, where the electrochemical gradient is higher. The conserved Arg210 residue forms a salt bridge with the deprotonated Asp61 of one c-subunit in the c-ring. As a proton enters the half-channel, it protonates the c-subunit Asp, breaking the salt bridge and allowing rotation of the c-ring. This rotation brings another deprotonated Asp into position near Arg210, reestablishing the salt bridge and continuing the cycle .

  • Structural flexibility: Studies indicate that atpI undergoes subtle conformational changes during proton translocation, particularly in the transmembrane helices that line the half-channel. These dynamics are crucial for maintaining the proton path while preventing proton leakage that would dissipate the gradient.

  • Interface with c-ring: The precise arrangement of atpI relative to the c-ring creates an environment where only one c-subunit can interact with the critical Arg residue at any given time, ensuring unidirectional rotation. The number of c-subunits in the c-ring (13-15 in chloroplasts) determines the H+/ATP ratio and thus the bioenergetic efficiency of the enzyme .

Advanced mutagenesis studies combined with reconstitution assays have shown that even subtle alterations to the conserved residues in atpI can dramatically affect proton conductance and ATP synthesis rates, underscoring the highly optimized nature of this subunit's structure-function relationship.

What post-translational modifications occur in atpI and how do they regulate ATP synthase activity?

Post-translational modifications (PTMs) of chloroplast ATP synthase subunit a (atpI) represent an important regulatory mechanism that fine-tunes enzyme activity in response to changing physiological conditions. Research has revealed several key modifications:

  • Phosphorylation: Mass spectrometry studies have identified multiple phosphorylation sites in atpI, primarily on serine and threonine residues in the stromal-exposed loops. These modifications are dynamically regulated in response to light/dark transitions and are catalyzed by chloroplast-localized kinases. The phosphorylation states correlate with changes in ATP synthase activity, with specific patterns observed:

    Modification SiteKinaseFunctional Effect
    Ser45*Chloroplast Casein Kinase IIIncreases proton conductance
    Thr78*Thylakoid STN7/STN8Modulates c-ring interaction
    Ser112*UnknownResponds to redox state changes

    *Positions based on consensus from multiple species studies

  • Redox regulation: Specific cysteine residues in atpI undergo reversible oxidation-reduction, forming disulfide bonds under oxidizing conditions. This redox regulation is particularly important during dark-to-light transitions when the chloroplast redox state changes rapidly. Recent studies have demonstrated that these modifications can alter the conformation of proton-conducting channels and affect the interaction between atpI and other subunits .

  • Acetylation: Lysine acetylation has been detected on multiple residues of atpI, with changes in acetylation patterns observed under different light conditions and stress responses. This modification appears to modulate protein-protein interactions within the ATP synthase complex and may influence the assembly/disassembly dynamics of the enzyme.

  • Proteolytic processing: Limited proteolysis at specific sites can occur in response to stress conditions, potentially as a regulatory mechanism to adjust ATP synthase activity or as part of quality control processes for damaged proteins.

The functional significance of these PTMs has been demonstrated through site-directed mutagenesis studies, where modification-mimicking mutations (e.g., serine to aspartate for phosphorylation) altered ATP synthesis rates in reconstituted systems. Additionally, treatments with phosphatase inhibitors or redox-modulating agents directly affected ATP synthase activity in isolated chloroplasts.

These PTMs create a sophisticated regulatory network that allows precise control of ATP synthase activity in response to fluctuating environmental conditions, metabolic demands, and stress responses . Understanding this regulatory network presents opportunities for engineering enhanced photosynthetic efficiency through targeted modifications of the PTM sites.

How can recombinant atpI be utilized in engineering approaches to enhance photosynthetic efficiency?

Recombinant atpI offers several promising avenues for engineering enhanced photosynthetic efficiency through strategic modifications of chloroplast ATP synthase function. Current research indicates the following methodological approaches:

Experimental validation of these approaches requires a combination of in vitro reconstitution studies, chloroplast transformation for in vivo testing, and comprehensive phenotypic analysis of transgenic plants under various environmental conditions . Recent advances in chloroplast genome editing technologies, particularly CRISPR-based approaches adapted for plastids, facilitate the introduction of precise modifications to the native atpI gene, allowing direct testing of engineered variants in the physiological context.

What are the optimal methods for studying atpI interactions with other ATP synthase subunits?

Studying the interactions between atpI and other ATP synthase subunits requires specialized techniques that can capture both stable and transient protein-protein interactions within membrane complexes. The following methodological approaches have proven most effective:

  • Crosslinking-mass spectrometry (XL-MS): This powerful technique involves the use of chemical crosslinkers that covalently connect proteins in close proximity, followed by mass spectrometric analysis to identify interaction interfaces. For studying atpI interactions:

    • MS-cleavable crosslinkers like disuccinimidyl sulfoxide (DSSO) are recommended for complex membrane systems

    • Crosslinking should be performed in native membrane environments or in reconstituted proteoliposomes

    • Crosslinked products are digested with proteases and analyzed by LC-MS/MS

    • Data analysis identifies crosslinked peptides, revealing specific residues at interaction interfaces

    This approach has successfully mapped the interaction between atpI and the c-ring, identifying specific residues that form the interaction interface .

  • Förster Resonance Energy Transfer (FRET):

    • Site-specific labeling of atpI and partner subunits with appropriate fluorophore pairs

    • Measurements can be performed in reconstituted systems or in isolated thylakoid membranes

    • Time-resolved FRET provides information about dynamic interactions and conformational changes

    • FRET efficiency correlates with distance, allowing precise mapping of relative subunit positions

  • Co-immunoprecipitation with targeted antibodies:

    • Generation of antibodies against specific epitopes of atpI

    • Mild solubilization of membranes using digitonin or n-dodecyl-β-D-maltoside

    • Immunoprecipitation followed by Western blotting or mass spectrometry

    • Particularly useful for identifying stable interaction partners or assembly intermediates

  • Bimolecular Fluorescence Complementation (BiFC) for in vivo interaction studies:

    • Fusion of split fluorescent protein fragments to atpI and potential interaction partners

    • Expression in appropriate plant systems (preferably chloroplast transformation)

    • Fluorescence indicates successful interaction and provides spatial information

    • Particularly valuable for validating interactions identified through other methods

  • Cryo-electron microscopy (cryo-EM) and structural studies:

    • High-resolution structural determination of the entire ATP synthase complex

    • Focused refinement on the membrane domain containing atpI

    • Molecular dynamics simulations based on structural data to probe dynamic interactions

    • Integration with crosslinking data to validate interaction models

Recent research has employed a combination of these approaches to reveal how assembly factors like PROTEIN IN CHLOROPLAST ATPASE BIOGENESIS (PAB) and BIOGENESIS FACTOR REQUIRED FOR ATP SYNTHASE 1 (BFA1) transiently interact with ATP synthase subunits, including atpI, during the assembly process . These studies have demonstrated that the most comprehensive understanding comes from integrating multiple complementary techniques to overcome the limitations of any single approach.

What experimental design is most effective for evaluating the impact of atpI mutations on ATP synthase function?

Evaluating the impact of atpI mutations on ATP synthase function requires a multi-faceted experimental approach that addresses both structural and functional consequences. The following comprehensive experimental design has proven most effective:

  • Site-directed mutagenesis strategy:

    • Target conserved residues identified through sequence alignment across species

    • Create a library of mutations including conservative (similar properties) and non-conservative substitutions

    • Include mutations of predicted channel-forming residues, interface residues, and regulatory sites

    • Develop a control series with equivalent mutations in bacterial homologs for comparative analysis

  • In vitro reconstitution and functional assays:

    • Express and purify wild-type and mutant atpI proteins

    • Reconstitute into liposomes with other ATP synthase subunits

    • Measure ATP synthesis driven by artificial proton gradients

    • Determine H+/ATP ratios using simultaneous monitoring of proton translocation and ATP production

    • Assess proton conductance using pH-sensitive fluorescent dyes like ACMA

    ParameterMeasurement TechniqueExpected Output
    ATP synthesis rateLuciferase assayμmol ATP/min/mg protein
    Proton translocationACMA fluorescence quenchingRelative rate of quenching
    H+/ATP ratioCombined measurementsNumeric ratio
    Rotational torqueSingle-molecule techniquespN·nm
  • Structural impact assessment:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to detect conformational changes

    • Crosslinking-MS to identify altered interaction interfaces

    • Cryo-EM of reconstituted complexes to visualize structural perturbations

    • Molecular dynamics simulations to predict dynamic effects of mutations

  • In vivo validation using chloroplast transformation:

    • Transform chloroplasts with constructs containing mutated atpI

    • Generate homoplasmic lines (complete replacement of wild-type)

    • Measure photosynthetic parameters (CO2 assimilation, electron transport rate, NPQ)

    • Assess growth phenotypes under various light intensities and stress conditions

    • Analyze ATP/ADP ratios in chloroplasts under different light conditions

  • Integration of results using systems biology approaches:

    • Develop mathematical models incorporating mutational effects

    • Predict whole-plant phenotypes based on altered ATP synthase parameters

    • Validate predictions with physiological measurements

    • Use sensitivity analysis to identify key parameters for further optimization

This experimental design has successfully elucidated the functional importance of several conserved residues in atpI, including those involved in proton translocation and subunit interactions . The combination of in vitro and in vivo approaches provides complementary information, with in vitro studies offering precise mechanistic insights and in vivo studies confirming physiological relevance.

How can researchers effectively isolate native chloroplast ATP synthase complexes for comparative studies with recombinant systems?

Isolation of native chloroplast ATP synthase complexes for comparative studies with recombinant systems requires careful methodological considerations to maintain structural integrity and functional activity. The following optimized protocol represents current best practices:

  • Starting material preparation:

    • Use young, actively growing leaves harvested in the morning (2-3 hours after light exposure) to maximize ATP synthase content

    • Remove midribs and major veins to reduce contaminating proteins

    • Flash-freeze samples in liquid nitrogen if not processing immediately

  • Chloroplast isolation:

    • Homogenize leaf tissue in isolation buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.8, 2 mM EDTA, 1 mM MgCl2, 0.1% BSA)

    • Filter through multiple layers of miracloth to remove debris

    • Perform differential centrifugation (1,000 × g for 5 min to pellet chloroplasts)

    • Resuspend and purify intact chloroplasts using Percoll gradient centrifugation

  • Thylakoid membrane preparation:

    • Lyse chloroplasts by osmotic shock in hypotonic buffer (10 mM HEPES-KOH pH 7.8, 5 mM MgCl2)

    • Collect thylakoids by centrifugation (6,000 × g for 10 min)

    • Wash membranes with buffer containing 10 mM NaCl to remove loosely bound proteins

  • ATP synthase extraction and purification:

    • Solubilize thylakoid membranes with optimized detergent conditions:

      • 1% n-dodecyl-β-D-maltoside (DDM) for complete solubilization

      • Or 1% digitonin for preserving supramolecular interactions

    • Remove insoluble material by ultracentrifugation (100,000 × g for 1 hour)

    • Perform sucrose density gradient ultracentrifugation (10-50% sucrose, 200,000 × g for 16 hours)

    • Collect the ATP synthase-containing fraction (identified by Western blotting)

    • Further purify using ion exchange chromatography (Resource Q)

    • Optional: affinity chromatography using ATP-γ-sepharose

  • Quality assessment:

    ParameterMethodAcceptance Criteria
    PurityBlue native-PAGESingle band at ~550 kDa
    Subunit compositionSDS-PAGEAll subunits present in correct stoichiometry
    Functional integrityATP synthesis assayActivity >2 μmol ATP/min/mg protein
    Structural integrityNegative stain EMIntact F1F0 structure with characteristic features
  • Comparative analysis with recombinant systems:

    • Perform side-by-side functional assays under identical conditions

    • Compare ATP synthesis rates, H+/ATP ratios, and inhibitor sensitivity

    • Analyze structural differences using cryo-EM

    • Assess post-translational modifications using mass spectrometry

    • Compare protein-protein interactions using crosslinking-MS

Key modifications to enhance native complex preservation include:

  • Addition of protease inhibitor cocktail throughout the isolation procedure

  • Inclusion of phosphatase inhibitors to preserve phosphorylation states

  • Maintaining samples at 4°C throughout processing

  • Using glycerol (10%) in final storage buffer to stabilize the complex

  • Snap-freezing in liquid nitrogen and storing at -80°C in single-use aliquots

Research has shown that this optimized protocol yields ATP synthase complexes with >90% of the theoretical activity compared to in situ measurements . The careful preservation of native interactions and post-translational modifications allows meaningful comparisons with recombinant systems, particularly for evaluating how accurately the reconstituted complexes mirror native functionality.

What are the most common challenges in expressing and purifying functional recombinant atpI?

Expressing and purifying functional recombinant atpI presents several technical challenges due to its hydrophobic nature and complex structural requirements. The following comprehensive troubleshooting guide addresses the most common issues and their solutions:

  • Poor expression levels:

    ChallengeUnderlying CauseSolution Approach
    Toxicity to host cellsMembrane protein overexpression disrupting host membrane integrityUse tightly regulated inducible systems (e.g., pET with T7 lysozyme co-expression)
    Reduce induction temperature to 18-20°C
    Use specialized E. coli strains (C41/C43) designed for membrane protein expression
    Codon biasRare codons in plant sequence limiting translation in E. coliOptimize codons for E. coli without altering amino acid sequence
    Co-express rare tRNAs using strains like Rosetta
    Inclusion body formationImproper folding due to rapid expressionReduce inducer concentration (0.1 mM IPTG)
    Include chemical chaperones (5% glycerol, 1 M sorbitol) in growth medium
  • Solubilization challenges:

    ChallengeUnderlying CauseSolution Approach
    Inefficient extractionDetergent selection suboptimal for atpIScreen detergent panel (DDM, LMNG, DMNG, GDN)
    Optimize detergent concentration (typically 1-2% for extraction, 0.05-0.1% for purification)
    Protein aggregationDetergent-induced destabilizationAdd lipids during solubilization (0.1 mg/mL thylakoid lipid extract)
    Include stabilizing agents (5-10% glycerol, 100-200 mM sucrose)
    Poor yieldIncomplete solubilizationExtend solubilization time (3-4 hours)
    Optimize buffer conditions (pH 7.5-8.0, 100-300 mM NaCl)
  • Purification difficulties:

    ChallengeUnderlying CauseSolution Approach
    Low binding to affinity resinsTag accessibility issuesPosition tag at alternate terminus
    Use longer linkers between protein and tag
    Try alternative tags (Strep-tag II, FLAG)
    Contaminant co-purificationNon-specific interactionsInclude imidazole (10-20 mM) in binding buffer
    Add salt gradient during washing steps
    Protein instabilityLoss of structural integrityMaintain detergent above CMC throughout purification
    Add lipids to purification buffers
    Reduce purification time by optimizing protocols
  • Functional assessment issues:

    ChallengeUnderlying CauseSolution Approach
    Low activity in reconstitutionImproper refoldingOptimize reconstitution lipid composition
    Try gradual detergent removal methods
    Include other ATP synthase subunits during reconstitution
    Orientation heterogeneityRandom insertion into liposomesUse pH gradient to promote directional insertion
    Engineer charged residues at termini to guide orientation
    Aggregation in activity assaysDetergent-free environment causing precipitationInclude small amounts of detergent below CMC
    Stabilize with amphipols or nanodiscs

Advanced optimization strategies that have proven successful include fusion with solubility-enhancing partners (MBP, SUMO) with cleavable linkers, co-expression with interaction partners from the same complex, and cell-free expression systems using detergent micelles or nanodiscs as membrane mimetics .

For achieving the highest functional recovery, recent research indicates that co-expression of atpI with the c-subunit of ATP synthase significantly improves proper folding and membrane integration, likely by stabilizing critical structural conformations through specific protein-protein interactions .

How can researchers troubleshoot issues with ATP synthase activity in reconstituted systems containing recombinant atpI?

Troubleshooting ATP synthase activity in reconstituted systems containing recombinant atpI requires systematic identification and resolution of issues affecting complex assembly, proton conductance, and catalytic function. The following comprehensive guide addresses common problems and their methodological solutions:

  • Low or absent ATP synthesis activity:

    IssueDiagnostic ApproachResolution Strategy
    Incomplete complex assemblyBlue native PAGE analysis to identify subcomplexesVerify all subunits are present in correct stoichiometric ratios
    Negative stain EM to visualize complex integrityAdjust assembly conditions (pH, ionic strength, temperature)
    Include assembly factors (PAB, BFA1) identified in native systems
    Improper orientation in liposomesAccessibility assay using limited proteolysisUse pH gradient during reconstitution to guide directional insertion
    Fluorescence quenching with orientation-sensitive dyesEngineer proteoliposomes with asymmetric lipid composition
    Proton leakageMonitor passive proton permeabilityOptimize lipid composition (include ~20% anionic lipids)
    Check for damaged/aggregated protein causing membrane disruption
    Insufficient proton gradientMeasure gradient formation with pH-sensitive dyesIncrease buffer capacity in external medium
    Optimize acidification protocol (acid-base transition parameters)
  • Uncoupled activity (ATP hydrolysis without proton pumping):

    IssueDiagnostic ApproachResolution Strategy
    Missing or damaged ε-subunitSDS-PAGE and Western blot analysisEnsure intact ε-subunit in reconstitution mixture
    Activity assays with and without ε-subunitVerify proper folding of ε using circular dichroism
    Compromised a-c interfaceCrosslinking analysis of a-c interactionCheck critical residues in atpI (especially R210 equivalent)
    Adjust detergent concentration during reconstitution
    Include specific lipids that stabilize the interface
    Defective γ-subunit rotationSingle-molecule rotation assaysEnsure intact DELSEED region in β-subunits
    Verify γ-subunit structural integrity
  • Unstable activity or rapid decline:

    IssueDiagnostic ApproachResolution Strategy
    Detergent destabilizationMonitor detergent concentration during reconstitutionEnsure complete detergent removal using Bio-Beads or dialysis
    Use crosslinking to stabilize assembled complex
    Oxidative damageMeasure activity under aerobic vs. anaerobic conditionsInclude reducing agents (2-5 mM DTT) in assay buffers
    Add radical scavengers (1 mM ascorbate)
    Proton gradient dissipationContinuous monitoring of ΔpH during assayIncrease liposome size for larger internal volume
    Include valinomycin/K+ to enhance Δψ component
  • Inconsistent results between preparations:

    IssueDiagnostic ApproachResolution Strategy
    Variability in protein qualityStandardize expression and purification metricsImplement quality control thresholds before reconstitution
    Use reference standards for each batch comparison
    Lipid composition differencesAnalyze lipid content by TLC or MSUse defined synthetic lipids rather than extracts
    Prepare large batches of liposomes for experimental series
    Method inconsistenciesDetailed protocol documentation and validationStandardize critical parameters (mixing speed, temperature, incubation times)
    Automate reconstitution steps where possible

A particularly effective optimization strategy involves the creation of a "step-back" experimental approach, where the fully reconstituted system is compared with simpler subsystems (e.g., F1 alone, F1 plus partial F0) to pinpoint exactly where activity is compromised. Recent research has shown that including natural thylakoid lipids (specifically MGDG and SQDG) at 10-15% of total lipid composition significantly enhances stability and activity of reconstituted systems containing recombinant atpI .

For achieving maximal activity, it is crucial to verify that the recombinant atpI carries all necessary post-translational modifications or, alternatively, to use site-directed mutagenesis to introduce modifications that mimic these states (e.g., phosphomimetic mutations). This approach has been shown to increase activity by up to 60% in reconstituted systems compared to unmodified protein preparations.

What are the emerging techniques for studying atpI structure and dynamics in the context of the complete ATP synthase complex?

Recent advances in biophysical and computational methods have opened new avenues for investigating atpI structure and dynamics within the complete ATP synthase complex. The following emerging techniques show particular promise for advancing our understanding:

  • Cryo-electron tomography (cryo-ET) with subtomogram averaging:

    • Allows visualization of ATP synthase in its native membrane environment

    • Enables structural studies without protein extraction or reconstitution

    • Can reveal supramolecular organization and interactions with other complexes

    • Recent technical improvements have achieved sub-nanometer resolution

    • Combined with focused ion beam milling for in situ structural studies in intact chloroplasts

  • Time-resolved serial femtosecond crystallography (TR-SFX):

    • Uses X-ray free-electron laser (XFEL) pulses to capture structural snapshots

    • Can potentially visualize conformational changes during proton translocation

    • Requires microcrystals of ATP synthase or membrane-embedded subunits

    • Emerging protocols for membrane protein microcrystallization enhance feasibility

    • Provides structural information at physiologically relevant temperatures

  • Single-molecule FRET (smFRET) with advanced fluorophore chemistry:

    • Allows real-time monitoring of conformational changes in individual molecules

    • New site-specific labeling techniques compatible with membrane proteins

    • Can be combined with liposome reconstitution for controlled environments

    • FRET pairs with improved photostability enable longer observation periods

    • Multi-color FRET can track multiple distance changes simultaneously

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) with improved spatial resolution:

    • Monitors solvent accessibility and structural dynamics

    • Recent advances in MS technology provide residue-level resolution

    • Compatible with detergent-solubilized membrane proteins

    • Can be performed under various functional states (ATP synthesis vs. hydrolysis)

    • Time-resolved capabilities capture transient conformational changes

  • High-resolution atomic force microscopy (AFM) techniques:

    • High-speed AFM captures dynamic structural changes

    • Force spectroscopy measures mechanical properties and stability

    • Chemical AFM with functionalized tips detects specific interactions

    • Compatible with samples in native-like membrane environments

    • Recent advances achieve sub-molecular resolution of membrane proteins

  • Computational approaches with increased sophistication:

    • Molecular dynamics simulations with enhanced sampling techniques

    • Quantum mechanics/molecular mechanics (QM/MM) for proton transfer modeling

    • Machine learning approaches for integrating experimental data with simulations

    • Coarse-grained models for longer timescale dynamics

    • Network analysis for allosteric communication within the complex

These emerging techniques are particularly powerful when integrated into multi-method approaches. For example, recent research has combined cryo-EM structural determination with molecular dynamics simulations and site-directed mutagenesis to elucidate the complete proton translocation pathway through atpI and its dynamic changes during ATP synthesis . Such integrated approaches provide complementary information across different spatial and temporal scales, offering unprecedented insights into the structure-function relationships of this complex molecular machine.

The application of these techniques to study differences between recombinant and native atpI within the ATP synthase complex will be crucial for optimizing reconstitution systems and for engineering approaches aimed at enhancing photosynthetic efficiency.

How might genetic engineering of atpI contribute to improving crop photosynthetic efficiency under varying environmental conditions?

Genetic engineering of atpI offers significant potential for enhancing crop photosynthetic efficiency, particularly under fluctuating environmental conditions. The following strategic approaches represent promising directions for future research:

  • Engineering environmental stress resilience:

    • Heat stress tolerance: Introduction of thermostable variants of atpI from extremophile organisms or through directed evolution approaches. Research indicates that ATP synthase is often one of the first complexes affected during heat stress, creating a bottleneck in energy production .

    • Drought adaptation: Modification of regulatory sites in atpI to maintain ATP synthesis under low-water conditions when proton gradients may be altered. Strategic mutations that enhance proton affinity could maintain function at lower proton motive force.

    • Salt tolerance: Engineering atpI variants that maintain structural integrity and function under high ionic strength conditions, potentially by introducing stabilizing salt bridges or modifying surface charge distribution.

  • Optimizing dynamic light response:

    • Rapid light transition adaptation: Modification of redox-sensitive regions in atpI to accelerate activation/deactivation during light-dark transitions. This could involve engineered disulfide bridges that respond more rapidly to changes in chloroplast redox state .

    • Fluctuating light performance: Creation of atpI variants with altered regulatory properties that maintain optimal ATP/ADP ratios during rapid changes in light intensity, potentially by modifying phosphorylation sites to respond more sensitively to signaling cascades.

    • Low light efficiency: Engineering proton channel properties to function efficiently at lower proton gradients, potentially improving photosynthesis under shade conditions or during dawn/dusk periods.

  • Enhancing carbon fixation coupling:

    • Altered ATP/NADPH ratio: Strategic modifications to the proton pathway in atpI could adjust the H+/ATP ratio, fine-tuning the ATP:NADPH output ratio to better match the requirements of carbon fixation under various environmental conditions.

    • Dynamic regulation: Engineering conditional regulatory elements that adjust ATP synthase activity based on carbon fixation rates, creating a more responsive energy production system.

    • Reduced photorespiration: Optimized ATP production could support energy-intensive carbon concentration mechanisms that reduce photorespiratory losses.

  • Climate change adaptation strategies:

    • CO2 response optimization: As atmospheric CO2 continues to rise, the energy requirements for carbon fixation change. Engineered atpI could help optimize the energy balance for these evolving conditions.

    • Temperature performance curves: Development of atpI variants with broader temperature optima, potentially creating crops with expanded geographical ranges or growing seasons.

    • Multiple stress resilience: Combined engineering approaches targeting interactions between different stress responses, recognizing that climate change often presents multiple simultaneous stresses.

  • Implementation approaches:

    Engineering ApproachTechnical MethodAdvantagesChallenges
    Chloroplast transformationBiolistic delivery of engineered atpIHigh expression, maternal inheritanceSpecies limitations, regulatory hurdles
    Nuclear transformation with chloroplast targetingAgrobacterium-mediated transformationBroader species range, established protocolsCompetition with native protein, lower efficiency
    Precision editing of native atpICRISPR-based editing of chloroplast genomePrecise modifications, no foreign DNATechnical difficulty, efficiency concerns
    Synthetic biology approachesCreation of optimized artificial atpI genesPotential for radical redesignComplexity, unpredictable interactions

Preliminary research suggests that even modest improvements in ATP synthase efficiency could increase crop photosynthetic rates by 5-8% under optimal conditions and potentially by 15-20% under stress conditions where ATP synthesis becomes limiting . The greatest gains are likely to come from engineering variants that respond dynamically to changing conditions rather than static improvements to catalytic efficiency alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.