Recombinant Lactuca sativa Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Hypotheses

While functional studies in L. sativa are sparse, inferences are drawn from:

  • Heme Interaction: Homology to bacterial heme-attachment proteins suggests a role in heme metabolism or electron transport chains .

  • Proton Extrusion and Carbon Uptake: In Chlamydomonas, cemA homologs promote proton gradients and inorganic carbon transport. Similar roles are hypothesized in angiosperms .

  • Stress Response: Chloroplast envelope proteins (e.g., NTT2, MEX1 in Arabidopsis) modulate solute transport during cold acclimation, hinting at potential stress-related functions for cemA .

Research Gaps

  • Direct Functional Studies: No experimental validation of cemA’s biochemical activity in L. sativa.

  • Localization Dynamics: Movement between chloroplast compartments or interactions with other envelope proteins remains unexplored.

Expression and Research Applications

Recombinant cemA has been expressed in E. coli for structural studies, but L. sativa-specific expression systems are underdeveloped. Key challenges include:

ApproachStatusExample
Heterologous ExpressionLimited to E. coli; chloroplast-based systems in L. sativa untested (Oryza sativa cemA model)
Chloroplast EngineeringFeasible (e.g., lettuce chloroplasts express dengue prM/E proteins)
ProteomicsNo cemA detection in lettuce stem proteomes

Potential Applications

  • Biotechnology: Chloroplast-based expression of cemA could enable production of heme-related compounds.

  • Climate Resilience: Leveraging cemA’s hypothesized stress-response roles to improve photosynthetic efficiency under adverse conditions.

Comparative Analysis with Related Proteins

cemA shares functional parallels with other chloroplast envelope proteins, such as:

ProteinOrganismFunctionSource
cemAL. sativaHeme interaction, proton extrusion
NTT2ArabidopsisATP/ADP antiporter; cold response
MEX1ArabidopsisMaltose exporter; starch metabolism
Chlamydomonas cemAChlamydomonasProton extrusion, carbon uptake

Future Research Directions

  1. Experimental Validation:

    • Purify recombinant cemA for biochemical assays (e.g., heme binding, proton transport).

    • Use CRISPR-Cas9 to generate cemA knockouts in L. sativa for phenotypic analysis.

  2. Stress-Response Studies:

    • Investigate cemA abundance under cold, drought, or high CO₂ conditions .

  3. Chloroplast-Based Engineering:

    • Adapt L. sativa chloroplast transformation systems (e.g., psbA regulatory elements) for cemA overexpression.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Lactuca sativa (Garden lettuce)
Target Names
cemA
Target Protein Sequence
MEKKKAFTPLLYLASIIFLPWWISLSFQKSMESWVTNWWNTRQSEPFLNDIEEKSILEKF IELEELLFLEEMIKEYSETHLQNLRIGIHKETIQLIKIHNEGRIHTILHFSTNIICFIIL SGYSLLGNKELVILNSWVQEFLYNLSDTIKAFSLLLLTDLCIGFHSPHGWELMIGFVYKD FGFVHNEQIISGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links

KEGG: lsv:3772786

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

Intermediate Research Questions

Advanced Research Questions

  • What strategies can be employed for site-directed mutagenesis of cemA to study structure-function relationships?

    Site-directed mutagenesis of cemA can be approached through several methodologies:

    1. PCR-based mutagenesis: Using overlapping primers containing the desired mutation to amplify the entire plasmid, followed by DpnI digestion to remove template DNA.

    2. Gibson Assembly: Designing fragments with overlapping ends containing mutations for seamless assembly.

    3. Golden Gate Assembly: Using Type IIS restriction enzymes for scarless assembly of multiple fragments, allowing simultaneous introduction of multiple mutations.

    4. CRISPR-Cas9 directed mutagenesis: For in vivo editing in plant systems.

    Key regions to target might include:

    • Predicted transmembrane domains

    • Conserved residues identified through sequence alignment with cemA homologs

    • Regions with high confidence in the structural model

    • Potential protein-protein interaction interfaces

    The mutant proteins should be expressed and characterized for proper folding, localization, and function to establish structure-function relationships .

  • How can protein-protein interactions of cemA be studied in the context of chloroplast function?

    Several complementary approaches can be used to study cemA protein interactions:

    ApproachMethodologyAdvantagesLimitations
    Yeast two-hybrid (Y2H)Express cemA (minus transit peptide) fused to DNA-binding domain and screen against prey libraryHigh-throughput screening; in vivo interactionFalse positives; membrane proteins challenging
    Split-ubiquitin systemMembrane-specific Y2H variantBetter suited for membrane proteinsLimited to binary interactions
    Co-immunoprecipitationPull-down using anti-cemA antibodiesDetects native complexesRequires optimization of detergents
    Proximity labelingBioID or APEX2 fused to cemAIdentifies proximal proteins in native environmentRequires expression of fusion protein
    Bimolecular Fluorescence ComplementationSplit fluorescent protein fragmentsVisualizes interactions in plant cellsPotential artifacts from irreversible assembly
    Crosslinking mass spectrometryChemical crosslinking followed by MSIdentifies interacting domainsTechnical complexity

    For chloroplast envelope proteins, proximity labeling approaches are particularly valuable as they can identify transient interactions and proteins in the same microenvironment without disrupting membrane integrity .

  • What regulatory considerations apply when conducting research with recombinant Lactuca sativa cemA?

    Research involving recombinant cemA from Lactuca sativa must comply with relevant biosafety guidelines:

    1. NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules:

      • Most experiments involving plant genes like cemA likely fall under Section III-D or III-E

      • Requires Institutional Biosafety Committee (IBC) approval prior to initiation

      • Risk assessment based on characteristics of the gene, vector, and host system

    2. Containment considerations:

      • Physical containment level typically BSL-1 for non-pathogenic plant genes

      • Plant containment facilities may be required if expressing in planta

      • Special considerations for chloroplast transformation experiments

    3. Environmental risk assessment if considering field trials or environmental release

    4. Material Transfer Agreements may be required if Lactuca sativa materials are obtained from other institutions

    Researchers should consult their institutional biosafety office for specific requirements before initiating work with recombinant cemA .

  • How can functional genomics approaches be applied to study the role of cemA in lettuce chloroplast biology?

    A comprehensive functional genomics strategy could include:

    1. CRISPR-Cas9 gene editing:

      • Generate knockouts or targeted mutations in cemA

      • Create cemA variants with epitope tags for localization and interaction studies

      • Introduce specific mutations to test functional hypotheses

    2. RNA interference (RNAi):

      • Virus-induced gene silencing (VIGS) using TRV vectors, similar to the approach used for LsMYB15 silencing in lettuce

      • Create stable RNAi lines with inducible silencing constructs

    3. Overexpression studies:

      • Express cemA under constitutive or inducible promoters

      • Create fusion proteins with reporters (GFP, YFP) to study localization

    4. Transcriptomics:

      • RNA-seq analysis comparing wild-type and cemA-modified plants

      • Identify genes co-regulated with cemA under various conditions

    5. Proteomics:

      • Compare chloroplast envelope proteome between wild-type and cemA-modified plants

      • Identify changes in protein abundance or modifications

    6. Metabolomics:

      • Analyze changes in metabolite profiles in cemA mutants

      • Focus on chloroplast-related metabolic pathways

    These approaches can be integrated with environmental stress studies (e.g., temperature, light) to understand cemA's role in stress responses .

  • What role might cemA play in stress responses like cold acclimation in lettuce, and how can this be investigated?

    While specific functions of cemA in stress responses remain to be elucidated, research approaches can be guided by studies of other chloroplast envelope proteins:

    1. Expression analysis:

      • qRT-PCR to measure cemA transcript levels under various stress conditions

      • Western blotting to track cemA protein levels during stress responses

    2. Comparative proteomics:

      • Label-free quantitative proteomics comparing envelope fractions from control and stress-treated plants

      • Calculate enrichment factors (EF) for cemA and interacting proteins under stress conditions

    3. Physiological phenotyping:

      • Compare wild-type and cemA-modified plants for stress tolerance

      • Measure photosynthetic parameters, ROS production, and stress markers

    4. Metabolite transport studies:

      • If cemA functions in metabolite transport, measure changes in metabolite flux under stress

      • Use reconstituted liposomes with recombinant cemA to test transport activities

    For cold acclimation specifically, envelope membrane lipid composition changes may affect cemA function, suggesting lipid analysis as an additional research direction .

  • How does the recombination rate in the genomic region containing cemA compare to other regions in the Lactuca sativa genome, and what implications does this have for genetic engineering?

    While specific recombination rates for the cemA region in Lactuca sativa are not directly reported in the provided sources, research on other gene clusters in lettuce provides relevant insights:

    • Studies of the Dm3 resistance gene cluster in lettuce showed recombination frequencies 18-fold lower than the genome average, with rare recombination events within gene clusters .

    • Similar patterns may exist for chloroplast-related nuclear genes, potentially affecting genetic engineering strategies.

    • For chloroplast genome-encoded genes, homologous recombination mechanisms differ from nuclear genes, with specific recombination regions like 16S-trnI and trnA-23S being utilized for chloroplast transformation .

    Implications for genetic engineering include:

    1. Need for careful design of homologous recombination regions when targeting cemA

    2. Potential use of chloroplast-specific vectors with endogenous promoters like Prrn

    3. Consideration of spontaneous mutation rates, which can reach 10⁻³ to 10⁻⁴ per generation for some lettuce genes

    4. Importance of screening multiple transformants to identify successful recombination events

  • What techniques are most effective for analyzing the topology and membrane integration of recombinant cemA?

    Analyzing the topology and membrane integration of recombinant cemA requires specialized techniques:

    TechniqueApplication to cemATechnical Considerations
    Protease protection assaysDetermine which domains are accessible from each side of the membraneRequires carefully isolated intact chloroplasts or reconstituted proteoliposomes
    Fluorescence quenchingMeasure accessibility of strategically placed fluorescent labelsRequires creation of labeled cemA variants
    Cysteine scanning mutagenesisReplace residues with cysteine and test accessibility to membrane-impermeable reagentsRequires removal of native cysteines and functional validation of mutants
    Förster resonance energy transfer (FRET)Measure distances between labeled sitesRequires paired fluorophores in specific locations
    Cryo-electron microscopyDirect visualization of membrane-embedded structureRequires highly purified, stable protein samples
    Atomic force microscopyTopographical imaging of membrane proteinsCan be performed in near-native conditions
    Sucrose gradient centrifugationVerify membrane association after extractionDistinguishes integral vs. peripheral membrane proteins

    These techniques should be used in combination to build a comprehensive model of cemA topology. Results can be compared with topology predictions from the AlphaFold structural model to refine our understanding of cemA's membrane integration.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.