Recombinant Lactuca sativa Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Lactuca sativa Cytochrome b6 (petB)

Recombinant Lactuca sativa cytochrome b6 (petB) is a bioengineered protein derived from the chloroplast-encoded petB gene of garden lettuce (Lactuca sativa). This protein is a core component of the cytochrome b6f complex, a critical electron transport chain complex in oxygenic photosynthesis . The recombinant form is produced in E. coli and includes an N-terminal histidine (His) tag to facilitate purification .

Role in Photosynthesis

Cytochrome b6 (petB) is integral to the cytochrome b6f complex, which facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI) while generating a proton gradient for ATP synthesis . In higher plants and algae, this complex also acts as a redox sensor, regulating light-harvesting dynamics and cyclic electron flow under stress .

Expression and Recombinant Design

The recombinant protein is produced in E. coli using standard bacterial expression systems. Key steps include:

  1. Cloning: The petB coding sequence is inserted into a plasmid with a His-tag for affinity chromatography.

  2. Overexpression: Induction under optimized growth conditions.

  3. Purification: Nickel-affinity chromatography followed by size-exclusion chromatography to achieve >90% purity .

Critical Handling Parameters

ParameterRecommendation
Storage-20°C/-80°C in aliquots (avoid repeated freeze-thaw cycles)
ReconstitutionUse sterile water or buffer; add glycerol (5–50%) for long-term stability
StabilityWorking aliquots stable at 4°C for 1 week; lyophilized powder stable at -20°C

Functional Studies

  1. State Transitions: Truncation of the petB C-terminus (e.g., ΔL215b6) disrupts heme ci binding and complex assembly, blocking STT7 kinase phosphorylation and light-harvesting complex migration .

  2. Electron Transfer Dynamics: Mutations in the heme ci propionate-binding residue (R207Kb6) slow phosphorylation kinetics, highlighting its role in redox signaling .

  3. Structural Analysis: Cryo-EM of spinach cytochrome b6f revealed PQ1 near the Qp site and PQ2 spanning the intermonomer cavity, enabling Q-cycle turnover .

Immunological Tools

Antibodies targeting the N-terminal region of petB (e.g., AS18 4169) enable detection via Western blot and blue native PAGE (BN-PAGE), confirming subunit integrity in thylakoid membranes .

Comparative Genomic Context

The petB gene resides in the chloroplast genome of L. sativa, within the LSC (Large Single-Copy) region. Comparative analyses of lettuce plastid genomes reveal conserved gene clusters, including petB alongside petA, petC, and petD, underscoring its evolutionary stability .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we are happy to accommodate specific requirements for the format. Please indicate your preference when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Lactuca sativa (Garden lettuce)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTDAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex. This complex plays a crucial role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitating cyclic electron flow around PSI, and regulating state transitions.
Database Links

KEGG: lsv:3772863

Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Cytochrome b6 in photosynthetic organisms?

Cytochrome b6 is a crucial component of the cytochrome b6f complex, which plays a central role in the photosynthetic electron transport chain of higher plants, green algae, and cyanobacteria. This complex catalyzes the oxidation of quinols and the reduction of plastocyanin, establishing the proton force required for ATP synthesis.

The cytochrome b6f complex consists of four major subunits:

  • petA gene product: a c-type cytochrome (cytochrome f)

  • petB gene product: a b-type/c-type cytochrome with three haems (cytochrome b6)

  • petD gene product: subunit IV (suIV)

  • petC gene product: the Rieske/Iron/sulfur protein

The complex serves as a key regulatory point between photosystem I and photosystem II, making it essential for balancing electron flow during photosynthesis .

What are recommended storage conditions for recombinant Cytochrome b6 protein?

For optimal stability of recombinant Lactuca sativa Cytochrome b6 protein:

  • Store at -20°C in a Tris-based buffer with 50% glycerol

  • For extended storage, conserve at -20°C or -80°C

  • Avoid repeated freezing and thawing cycles

  • Store working aliquots at 4°C for up to one week

Lyophilized antibodies against Cytochrome b6 can be stored at -20°C for up to 3 years. Once reconstituted, these antibodies can be stored at 4°C for several days to weeks. Making aliquots is recommended to avoid freeze-thaw cycles .

What expression systems and vectors are effective for producing recombinant Cytochrome b6?

Based on the search results, several expression systems have proven effective:

  • Prokaryotic expression systems: The pET28a+ vector has been successfully used for the expression of cytochrome proteins in E. coli BL21 cells. This system allows for high-yield protein production and includes kanamycin resistance for selection .

  • Plant chloroplast transformation: In Marchantia, researchers have created effective tools for protein hyperexpression in chloroplasts using specific 5'UTR sequences from the petB gene coupled with appropriate promoters .

The engineering of these expression systems typically requires:

  • Appropriate selection of restriction sites (such as EcoRI and BamHI)

  • Inclusion of promoter sequences optimized for the target organism

  • Addition of ribosome binding sites for efficient translation

Research Applications and Techniques

Researchers can employ several approaches to study the assembly and stability of the cytochrome b6f complex:

  • Site-directed mutagenesis: Modifications to the C-terminus of the cyt b6 subunit (PetB) can be used to study structural requirements for complex assembly. For example, truncation (removing L215b6) or elongation (adding G216b6) of the cyt b6 subunit can reveal the importance of specific residues .

  • Protease inhibition studies: In Chlamydomonas reinhardtii, researchers have shown that modified complexes lacking proper salt bridge formation between cyt b6 (PetB) and Subunit IV (PetD) are degraded by FTSH protease. Creating double mutants where FTSH is inactivated allows for the accumulation of modified complexes for further study .

  • Heme analysis: The presence and function of heme ci can be studied by replacing the arginine interacting with heme ci propionate (R207Kb6), allowing researchers to investigate the role of this cofactor in complex assembly and function .

These techniques provide valuable insights into the structural requirements for cytochrome b6f complex assembly and the functional relationships between its components.

How does the C-terminus of Cytochrome b6 influence state transitions in photosynthesis?

Recent research has revealed that the C-terminus of the Cytochrome b6 (PetB) subunit plays a critical role in regulating state transitions—the process that distributes light energy between photosystem I (PSI) and photosystem II (PSII).

In Chlamydomonas reinhardtii, state transitions involve:

  • Reduction of the plastoquinone pool

  • Activation of the state transitions 7 (STT7) protein kinase by the cytochrome b6f complex

  • Phosphorylation and migration of light harvesting complexes II (LHCII)

Research has demonstrated that modifications to the C-terminus of PetB affect the phosphorylation of STT7 and subsequent state transitions. Specifically:

  • Truncation (removal of L215b6) or elongation (addition of G216b6) of the cyt b6 subunit results in complexes that lack heme ci and are degraded by FTSH protease

  • Salt bridge formation between cyt b6 (PetB) and Subunit IV (PetD) is essential for complex assembly

  • In double mutants where FTSH is inactivated, modified cyt b6f accumulates but the phosphorylation cascade is blocked

  • Replacement of the arginine interacting with heme ci propionate (R207Kb6) results in slower phosphorylation kinetics

These findings demonstrate that the structural integrity of the C-terminus is essential for proper signal transduction during state transitions.

How do researchers manipulate the 5'UTR regions of petB to optimize protein expression in chloroplasts?

Optimizing protein expression in chloroplasts involves strategic manipulation of the 5'UTR regions of genes like petB. Researchers have developed several approaches:

  • Hybrid promoter elements: Researchers have fused the tobacco (Nicotiana tabacum) psbA promoter (61 bp) with various 5'UTR sequences from Marchantia, including the petB gene (58 bp), to create customized expression tools .

  • Intergenic region utilization: The intergenic region between psbH and petB genes (104 bp) has been shown to confer high levels of protein expression when used as a 5'UTR for transgenes .

  • PPR binding site manipulation: Pentatricopeptide repeat (PPR) proteins bind to specific sites in the 5'UTR and affect mRNA stability and translation. Researchers have found that:

    • Mutations in the putative HCF152 PPR binding site in the psbH-petB intergenic region reduce fluorescence levels of reporter proteins

    • Mutations in the PPR binding site of the petB sequence did not significantly reduce fluorescence, suggesting differential regulation

  • Ribosome binding site optimization: Inclusion of synthetic ribosome binding sequences enhances translation efficiency in chloroplast expression systems .

Comparative testing revealed that the psbH-petB intergenic region and the rbcL 5'UTR were the best candidates for generating high-level gene expression in Marchantia chloroplasts, with a single inserted gene producing up to 15% of total soluble protein .

What role does Cytochrome b6f play in balancing photosynthetic complex stoichiometry under varying environmental conditions?

The cytochrome b6f complex plays a crucial role in adjusting photosynthetic electron transport to metabolic demand under fluctuating environmental conditions. This balancing act is essential for minimizing cytotoxic side reactions such as the production of reactive oxygen species.

Key aspects of this regulatory role include:

  • Light quality adaptation: When plants grow under different light qualities, the cytochrome b6f complex content can change substantially to maintain optimal electron flow. In Arabidopsis thaliana, 'PSII light' results in an almost 50% increase in cytochrome b6f complex levels, which is even more prominent than photosystem stoichiometry adjustments .

  • Co-regulation with ATP synthase: Cytochrome b6f complex and ATP synthase contents are strictly co-regulated to keep the proton motive force (pmf) across the thylakoid membrane in an optimal range. This coordination:

    • Allows efficient ATP synthesis under light-limited conditions

    • Minimizes the activation of unnecessary photoprotective mechanisms

    • Maintains appropriate thylakoid lumen pH

  • Structural dynamics for electron transfer: The Rieske protein of the cytochrome b6f complex contains an N-terminal membrane anchor domain and a larger luminal domain binding the 2Fe2S cluster. To transfer electrons efficiently, the luminal domain must move from its position near the Qp-side to a position close enough to the heme in cytochrome f .

This dynamic regulation of cytochrome b6f complex content and activity represents a sophisticated mechanism for plants to maintain photosynthetic efficiency across diverse environmental conditions.

What purification methods are most effective for isolating functional recombinant Cytochrome b6 protein?

Based on the research literature, the following purification workflow has proven effective for cytochrome proteins:

  • Cell lysis and initial fractionation:

    • Resuspend cells in lysis buffer (typically 50 mM Tris-HCl pH 7.5)

    • Sonicate or use other disruption methods

    • Centrifuge at high speed (e.g., 12,000 × g for 30 min) to remove debris

  • Affinity chromatography:

    • For His-tagged proteins, pass the filtered supernatant through a Ni²⁺-chelating affinity chromatography column

    • Wash with buffer containing low imidazole concentration (e.g., 50 mM Tris-HCl pH 7.5 and 50 mM imidazole)

    • Elute with increased imidazole concentration (e.g., 50 mM Tris-HCl pH 7.5 and 100 mM imidazole)

  • Concentration and buffer exchange:

    • Concentrate and dialyze against appropriate buffer using ultrafiltration with amicon ultracentrifuge filter devices

    • Evaluate protein purity by SDS-PAGE (12%)

    • Determine protein concentration using BCA Protein Assay with BSA as standard

For activity assays, the purified protein can be tested in reaction mixtures containing appropriate buffers and substrates, with the enzyme activity assessed by measuring product generation via techniques such as HPLC .

How can researchers effectively analyze mutations in the petB gene and their effects on photosynthetic function?

Analysis of petB mutations requires a multi-faceted approach:

  • Site-directed mutagenesis: Researchers can use techniques like CRISPR-Cas9 or traditional site-directed mutagenesis to modify specific residues in the petB gene. Key targets include:

    • C-terminal residues involved in complex assembly

    • Residues interacting with cofactors like heme ci

    • Regions involved in protein-protein interactions

  • Functional assays:

    • State transition analysis: Measuring the kinetics of LHCII phosphorylation and migration between photosystems

    • Phosphorylation cascade analysis: Monitoring the phosphorylation states of STT7 kinase and LHCII targets

    • Electron transport measurements: Determining the efficiency of electron flow through the cytochrome b6f complex

  • Structural analysis:

    • Complex assembly assessment: Using Blue Native PAGE to analyze the integrity of cytochrome b6f complex assembly

    • Protease sensitivity studies: Testing the susceptibility of modified complexes to degradation by proteases like FTSH

    • Cofactor incorporation: Analyzing the presence and functionality of heme groups within the modified complex

These approaches allow researchers to establish clear structure-function relationships for specific regions of the Cytochrome b6 protein, providing insights into its role in photosynthetic electron transport and regulatory processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.