Recombinant Lactuca sativa NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplasts

The NDH complex, including ndhA, mediates two key processes:

  • Cyclic electron flow (CEF): Recirculates electrons from photosystem I (PSI) to the plastoquinone (PQ) pool, balancing ATP/NADPH ratios during photosynthesis .

  • Chlororespiration: Maintains redox homeostasis by oxidizing NADPH and reducing PQ under stress conditions .

Electron transfer occurs via a conserved pathway:
NAD(P)HFMNFe-S clustersPlastoquinone\text{NAD(P)H} \rightarrow \text{FMN} \rightarrow \text{Fe-S clusters} \rightarrow \text{Plastoquinone}
This process is coupled to proton translocation, generating a proton gradient for ATP synthesis .

Expression Systems

  • Host organisms: E. coli is commonly used for heterologous expression due to its scalability .

  • Purification: Affinity chromatography tags (e.g., His-tag) facilitate isolation of active ndhA .

Research Applications

  • Mechanistic studies: Cryo-EM structures of homologous NDH complexes (e.g., cyanobacterial NDH-1L) reveal PQ-binding chambers and electron transfer pathways, informing lettuce ndhA’s role .

  • Stress response analysis: Overexpression of ndhA in transgenic plants enhances tolerance to oxidative stress by modulating PQ pool redox states .

Key Research Findings

  • Structural insights: The NDH complex’s PQ-binding chamber in L. sativa shares conformational flexibility with cyanobacterial homologs, suggesting conserved mechanisms for quinone reduction .

  • Antioxidant linkage: Lettuce lines with elevated NDH activity show increased glutathione and catalase levels, correlating with reduced oxidative damage .

  • Genetic diversity: Genome-wide association studies (GWAS) in lettuce identify SNPs near ndhA-linked loci associated with vitamin C content, hinting at metabolic interplay .

Challenges and Future Directions

  • Functional redundancy: Type II NAD(P)H dehydrogenases (e.g., NDC1) partially compensate for NDH defects, complicating phenotypic analysis .

  • Biotechnological potential: Engineering ndhA could optimize photosynthesis in crops under fluctuating light conditions .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate any special format requirements. Please specify your preferred format in the order notes and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We recommend storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type preference, please inform us and we will prioritize the development of your requested tag.
Synonyms
ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-363
Protein Length
full length protein
Species
Lactuca sativa (Garden lettuce)
Target Names
ndhA
Target Protein Sequence
MIIDTTEVQAINSFSILESLKEVYGIIWMLIPIFTLVLGITIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQALADGTKLLFKENLLPSRGDTRLFSIGPSIAVISILLSYLVIPFSY HLVLADLSIGVFLWIAISSIAPVGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFLVFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNLSIPYIFVPEVFEITKRGRV FGTIIGIFITLAKTYLFLFIPIATRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTCSQL ISL
Uniprot No.

Target Background

Function
NDH (NAD(P)H dehydrogenase) facilitates electron transfer from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. The primary electron acceptor for this enzyme is believed to be plastoquinone. NDH couples the redox reaction to proton translocation, thus conserving the redox energy within a proton gradient.
Database Links

KEGG: lsv:3772850

Protein Families
Complex I subunit 1 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of NdhA in Lactuca sativa?

NdhA is a crucial membrane-embedded subunit of the chloroplast NADH dehydrogenase-like (NDH) complex in Lactuca sativa (lettuce). It functions primarily at the connecting site between the peripheral arm (SubA) and the membrane subcomplex (SubM) of the NDH complex . This protein plays an essential role in mediating electron transport from ferredoxin to plastoquinone in the thylakoid membrane, contributing to cyclic electron flow around photosystem I and chlororespiration . The NDH complex containing functional NdhA participates in maintaining redox balance in the chloroplast and contributes to ATP production, particularly under stress conditions.

How is the ndhA gene structured in Lactuca sativa?

The ndhA gene in Lactuca sativa is encoded in the plastid genome and contains a group II intron that requires proper splicing for functional protein expression . Efficient splicing of this intron depends on nuclear-encoded factors, particularly the P-class pentatricopeptide repeat protein CRR16 . Analysis of the crr16 mutant in Arabidopsis has demonstrated that impaired splicing of the ndhA transcript directly affects the accumulation of functional NdhA protein and consequently NDH complex activity . The mature ndhA transcript encodes a membrane protein with multiple transmembrane domains that integrate into the thylakoid membrane, forming part of the NDH complex architecture.

What role does NdhA play in the chloroplast NDH complex assembly?

NdhA serves as a critical architectural component for the structural integrity and assembly of the NDH complex. Research using NdhA knockout models has demonstrated that this protein is essential for stabilizing SubA (the peripheral arm containing electron transport components) and SubE but not for the accumulation of the other three subcomplexes . Biochemical analyses of crr16 and ΔndhA plants indicate that without functional NdhA, the peripheral arm cannot properly integrate with the membrane-embedded portion of the complex, leading to impaired NDH activity . This evidence establishes NdhA as a key connector that facilitates the incorporation of the electron transport machinery into the membrane structure, enabling the formation of a functional NDH-PSI supercomplex.

What are the optimal methods for recombinant expression of Lactuca sativa ndhA?

The optimal expression of recombinant Lactuca sativa ndhA requires specialized approaches due to its nature as a membrane protein. The most effective methods include:

Agrobacterium-mediated transformation:

  • Using binary vectors with appropriate selectable markers (Kanamycin, Hygromycin, Spectinomycin)

  • Transformation of lettuce hypocotyl tissues with Agrobacterium strains such as GV3111, LBA4404, or GV3101

  • Selection of transformants on appropriate antibiotic-containing media

  • Regeneration of transplastomic plants with proper integration of the ndhA gene

Chloroplast transformation:

  • Direct transformation of chloroplasts using biolistic methods

  • Selection based on spectinomycin resistance

  • Confirmation of transplastomic status through PCR and Southern blotting

  • This approach often yields higher expression levels as demonstrated by successful transplastomic lettuce plants that "grew normally on soil"

For functional studies, expression systems that maintain the membrane environment are crucial. The transformation efficiency can be monitored through spectinomycin-resistant green callus and shoots on selection plates, followed by development of transplastomic lettuce plants .

What challenges arise when expressing membrane proteins like NdhA?

Expression of membrane proteins like NdhA presents several significant challenges:

Structural challenges:

  • Multiple transmembrane domains leading to hydrophobicity issues

  • Potential toxicity to host cells during overexpression

  • Proper folding dependent on the membrane environment

  • Risk of aggregation and inclusion body formation

Expression system limitations:

  • Differences in membrane composition between expression hosts and native environment

  • Limitations in membrane surface area for protein insertion

  • Potential lack of specific chaperones required for proper folding

  • Codon usage bias affecting translation efficiency

Functional assessment difficulties:

  • Need for reconstitution into liposomes or nanodiscs for functional studies

  • Complex interaction with other NDH subunits required for full activity

  • Requirement for specific lipid environments to maintain native conformation

To address these challenges, researchers typically employ specialized techniques such as using mild detergents, membrane-mimetic systems, and co-expression of interacting partners. Chloroplast transformation systems have proven particularly effective for expressing plastid-encoded proteins like NdhA in their native environment .

How can the purity and functionality of recombinant NdhA be assessed?

Assessment of recombinant NdhA purity and functionality requires multiple complementary approaches:

Purity assessment methods:

  • SDS-PAGE analysis with gradient gels and specific detergent concentrations

  • Immunoblotting with antibodies against NdhA or epitope tags

  • Mass spectrometry for precise identification and purity verification

  • Blue Native PAGE to assess incorporation into native complexes

Functionality verification:

  • Chlorophyll fluorescence measurements to detect NDH activity through the post-illumination rise in fluorescence

  • Electron transport assays using artificial electron donors (NADH/NADPH) and acceptors (quinones)

  • Complementation of ndhA mutants to confirm functional restoration

  • Activity comparison between wild-type and recombinant protein in identical buffer conditions

Structural integrity evaluation:

  • Circular dichroism to verify secondary structure elements

  • Protease resistance patterns compared to native protein

  • Membrane integration assessment through fractionation studies

For complete functional assessment, the recombinant NdhA should demonstrate ability to incorporate into the NDH complex and restore electron transport activity in NdhA-deficient systems.

How can the electron transport activity of recombinant NdhA be measured?

Measuring electron transport activity involving NdhA requires specialized approaches since it functions as part of the larger NDH complex:

Chlorophyll fluorescence techniques:

  • Post-illumination fluorescence rise measurement, which specifically reflects NDH activity

  • PAM (Pulse Amplitude Modulation) fluorometry to detect transient increases in fluorescence after switching from light to dark

  • Comparison of fluorescence parameters between wild-type and NdhA-deficient samples

In vitro assays:

  • Measurement of NADH/NADPH oxidation rates spectrophotometrically at 340 nm

  • Oxygen consumption measurements using Clark-type electrodes

  • Artificial electron acceptors (various quinones) to monitor electron flow

Experimental parameters:

  • Temperature: 25°C (standard), with variations to determine temperature sensitivity

  • pH range: 7.0-8.0 (optimal for NDH complex activity)

  • Buffer composition: typically containing magnesium ions and appropriate osmotica

Importantly, the electron transport activity should be compared between active enzyme and appropriate controls, including heat-inactivated enzyme and specific inhibitors of the NDH complex, to confirm specificity of the measured activity.

What methods can be used to assess the superoxide scavenging properties of NdhA?

Assessment of superoxide scavenging properties can be performed using several complementary approaches:

Direct superoxide detection methods:

  • Dihydroethidium (DHE) oxidation inhibition assay

  • Cytochrome c reduction assay

  • Pyrogallol auto-oxidation inhibition

Oxygen consumption measurements:

  • Clark-type oxygen electrode to monitor oxygen consumption to NADH oxidation ratio (1:1 stoichiometry indicates superoxide scavenging activity)

  • Analysis of auto-oxidation rates of fully reduced NdhA in the presence and absence of superoxide

Hydrogen peroxide production:

  • The auto-oxidation of fully reduced NdhA protein results in hydrogen peroxide production, which can be quantified

  • This corresponds to superoxide scavenging activity, as the addition of superoxide dismutase inhibits this auto-oxidation process

Superoxide sources for testing:

  • Xanthine/xanthine oxidase system

  • Potassium superoxide as a direct superoxide source

  • NADPH oxidase systems

The data from search result indicates that NAD(P)H:quinone oxidoreductase can function as a superoxide scavenger, showing accelerated auto-oxidation in the presence of superoxide and inhibition of this auto-oxidation by superoxide dismutase . This methodology can be applied to assess the superoxide scavenging properties of recombinant NdhA.

How does NdhA interact with other components of the NDH-PSI supercomplex?

NdhA interactions within the NDH-PSI supercomplex involve multiple molecular interfaces that can be studied through various approaches:

Biochemical evidence:

  • NdhA serves as a critical connector between the peripheral arm (SubA) and the membrane subcomplex (SubM)

  • When NdhA is absent or its biogenesis is impaired (as in the crr16 mutant), the peripheral arm fails to incorporate properly into the membrane subcomplex

  • This leads to destabilization of both SubA and SubE while not affecting the accumulation of other subcomplexes

Interaction analysis methods:

  • Co-immunoprecipitation with antibodies against NdhA or interacting partners

  • Blue native PAGE to preserve native complex interactions

  • Cross-linking mass spectrometry to identify specific interaction sites

  • Cryo-electron microscopy of the intact NDH-PSI supercomplex

Functional consequences of interactions:

  • The proper integration of NdhA is essential for electron transport activity

  • NdhA provides structural stability to the entire complex

  • It forms part of the architecture that allows efficient electron flow from ferredoxin to plastoquinone

The evidence from knockout studies clearly establishes NdhA as an architectural protein that facilitates the incorporation of the peripheral arm containing the electron transport components into the membrane-embedded part of the complex .

What controls should be included when studying recombinant NdhA function?

When designing experiments to study recombinant NdhA function, comprehensive controls are critical for valid interpretation:

Negative controls:

  • Denatured NdhA protein (heat-treated) to control for non-specific effects

  • Membrane preparations from expression systems lacking the ndhA gene

  • Reactions lacking electron donors (NADH/NADPH) or acceptors (quinones)

  • NdhA knockout or mutant samples (such as material from the crr16 mutant or ΔndhA plants)

Positive controls:

  • Purified native NDH complex from wild-type Lactuca sativa chloroplasts

  • Wild-type plants with confirmed NDH activity (through chlorophyll fluorescence)

  • Reconstituted systems with known activity levels

System validation controls:

  • Superoxide dismutase (SOD) in superoxide scavenging assays

  • Known electron transport inhibitors at established concentrations

  • Measurements under varying light conditions to confirm light-dependent effects

Genetic complementation controls:

  • Restoration of NdhA function in ndhA-deficient mutants (ΔndhA)

  • Expression of NdhA variants with point mutations in key residues

  • Comparison with other species' NdhA to establish conservation of function

Environmental parameter controls:

  • Temperature ranges to establish temperature optima and sensitivity

  • pH series to determine pH optimum and effects on activity

  • Light/dark transitions to evaluate physiological relevance

These controls ensure that the observed effects are specifically attributable to NdhA function and not to artifacts or confounding factors in the experimental system.

How can site-directed mutagenesis be used to study NdhA structure-function relationships?

Site-directed mutagenesis provides a powerful approach to dissect NdhA structure-function relationships:

Target selection strategies:

  • Evolutionary conservation analysis to identify highly conserved residues

  • Homology modeling based on related proteins with known structures

  • Prediction of functionally important motifs (transmembrane regions, binding sites)

  • Analysis of regions at the interface between SubA and SubM where NdhA plays a connecting role

Types of mutations to employ:

  • Conservative substitutions to test subtle effects

  • Non-conservative substitutions to significantly alter properties

  • Alanine scanning of transmembrane regions or predicted interaction surfaces

  • Introduction or removal of protonatable residues in potential proton channels

  • Mutations targeting the regions involved in connecting SubA to the membrane domain

Functional analysis of mutants:

  • Electron transport activity measurements

  • Complex assembly efficiency through Blue Native PAGE

  • Interaction with other subunits via co-immunoprecipitation

  • In vivo phenotype analysis in transformed plants

  • Ability to restore NDH function in NdhA-deficient backgrounds

This approach can specifically address how NdhA fulfills its role in connecting the peripheral arm to the membrane domain of the NDH complex, providing insights into the structural basis of this critical function .

What approaches can be used to study the role of NdhA in stress response mechanisms?

NdhA and the NDH complex play significant roles in plant stress responses, which can be studied through multiple approaches:

Physiological measurements:

  • Chlorophyll fluorescence to assess NDH activity under various stresses

  • Photosynthetic parameters (CO2 assimilation, electron transport rates)

  • Reactive oxygen species (ROS) detection and quantification

  • Membrane integrity assessments under stress conditions

Molecular analysis:

  • Expression profiling of ndhA and related genes under stress conditions

  • Protein abundance and modification analysis during stress

  • Comparison between wild-type and NdhA-deficient plants (such as crr16 or ΔndhA)

  • Correlations between NDH activity and stress tolerance

Stress conditions to evaluate:

  • High light stress (which typically increases cyclic electron flow demand)

  • Drought stress (affecting carbon fixation and increasing photorespiration)

  • Temperature extremes (both cold and heat)

  • Combined stresses that reflect field conditions

Functional analyses:

  • Superoxide scavenging capacity under stress conditions

  • ATP/NADPH ratio measurements

  • Electron transport rates and cyclic electron flow assessment

  • Comparison of photoinhibition between wild-type and NdhA-deficient plants

Research has shown that NAD(P)H:quinone oxidoreductase can function as a superoxide scavenger , suggesting that NdhA may contribute to stress tolerance not only through its role in electron transport but also through direct ROS scavenging activities, which should be evaluated under various stress conditions.

How can cryo-electron microscopy elucidate NdhA structural characteristics?

Cryo-electron microscopy (cryo-EM) offers powerful approaches for determining the structure of membrane proteins like NdhA at near-atomic resolution:

Sample preparation strategies:

  • Isolation of intact NDH or NDH-PSI supercomplex from native or recombinant sources

  • Detergent screening to identify optimal solubilization conditions

  • Alternative membrane mimetics such as nanodiscs or amphipols

  • Careful concentration to achieve suitable particle density without aggregation

Data collection parameters:

  • High-end microscopes (300 kV) with direct electron detectors

  • Energy filters to enhance contrast for membrane proteins

  • Multiple tilt series acquisition for tomography approaches

  • Collection of thousands of micrographs to ensure sufficient particle numbers

Processing workflows:

  • Motion correction and CTF estimation

  • Particle picking using template-based or neural network approaches

  • 3D reconstruction with focused refinement on the NdhA region

  • Local resolution estimation to identify well-resolved regions

Structural insights possible:

  • Determination of transmembrane topology and stromal/lumenal extensions

  • Identification of the structural basis for NdhA's role as a connector between SubA and SubM

  • Visualization of interaction interfaces with other NDH components

  • Mapping of amino acids crucial for assembly and stability

  • Understanding the structural basis for NDH defects in mutants like crr16

Cryo-EM can reveal how NdhA structurally bridges the membrane and stromal parts of the complex, providing atomic-level insights into its essential architectural role.

What methodologies can assess the impact of post-translational modifications on NdhA function?

Post-translational modifications (PTMs) of NdhA may regulate its function, stability, and interactions. Advanced methodologies to study these modifications include:

Identification approaches:

  • Mass spectrometry-based proteomics with enrichment strategies for:

    • Phosphorylation sites (TiO₂ enrichment, IMAC)

    • Acetylation (antibody enrichment)

    • Redox modifications (differential alkylation)

  • Site-specific antibodies against known or predicted modification sites

  • Comparison of modification patterns between control and stress conditions

Functional analysis methods:

  • Site-directed mutagenesis to generate phosphomimetic or phospho-null variants

  • In vitro modification using purified enzymes (kinases, acetyltransferases)

  • Activity assays comparing modified and unmodified forms

  • Structural studies to determine conformational changes upon modification

Regulatory studies:

  • Analysis of modification dynamics during light/dark transitions

  • Stress-induced changes in modification patterns

  • Identification of enzymes responsible for specific modifications

  • Correlation of modification status with NDH activity and complex stability

Physiological impact assessment:

  • Comparison of electron transport rates between wild-type and modification-site mutants

  • Assessment of complex assembly efficiency

  • Evaluation of stress tolerance in plants expressing modification-site mutants

  • Analysis of interactions with other NDH components in the presence/absence of modifications

Understanding how PTMs regulate NdhA can provide insights into the dynamic regulation of NDH complex function under changing environmental conditions.

How can genetic engineering of ndhA improve stress tolerance in Lactuca sativa?

Genetic engineering of ndhA offers potential for enhancing stress tolerance in lettuce through several approaches:

Engineering strategies:

  • Overexpression of optimized ndhA to enhance NDH complex function

  • Introduction of specific mutations to improve stress-responsive regulation

  • Promoter modifications to alter expression patterns under stress

  • Expression of ndhA variants from stress-tolerant species

Transformation methods:

  • Agrobacterium-mediated transformation using various strains (GV3111, LBA4404, GV3101)

  • Chloroplast transformation for precise integration and high expression levels

  • CRISPR/Cas9 gene editing for targeted modifications of the native gene

  • RNAi or VIGS for functional validation prior to stable transformation

Stress tolerance assessment:

  • Measurement of photosynthetic parameters under stress conditions

  • Growth and yield analysis under field-like stress scenarios

  • ROS production and antioxidant capacity evaluation

  • Transcriptomic and metabolomic analyses to assess global impacts

Advanced applications:

  • Stacking of modified ndhA with other stress tolerance genes

  • Development of stress-inducible expression systems

  • Creation of lettuce varieties with enhanced adaptation to specific environmental challenges

  • Utilization of base editing techniques for precise modifications without DNA double-strand breaks

Lifeasible offers various genetic engineering technologies that could be applied to ndhA modification, including overexpression systems, RNAi, VIGS, and CRISPR-based approaches, which can be customized for different genetic backgrounds of Lactuca sativa .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.