Recombinant Lactuca sativa NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

What is the functional role of ndhC in Lactuca sativa chloroplasts?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is an essential component of the chloroplast NAD(P)H dehydrogenase complex, which functions as a homologue of mitochondrial complex I. In Lactuca sativa, this protein plays a critical role in cyclic electron flow around photosystem I and in photoprotection during stress conditions. The chloroplastic NDH complex consists of more than 15 subunits, with 11 encoded by the chloroplast genome (ndhA-K) . The ndhC gene specifically encodes a membrane-spanning subunit that contributes to the proton-pumping function of the complex, helping generate a proton gradient across the thylakoid membrane that drives ATP synthesis .

Experimental evidence demonstrates that the NDH complex is upregulated under photooxidative stress conditions, suggesting its importance in stress adaptation mechanisms. Studies in barley have shown that hydrogen peroxide serves as a signaling molecule mediating the induction of chloroplastic ndh genes, including ndhC, under such stress conditions .

How is the ndhC gene organized in the chloroplast genome of lettuce?

The ndhC gene in Lactuca sativa is located within the large single copy (LSC) region of the chloroplast genome. One notable characteristic of this gene is that it partially overlaps with the ndhK gene, and both are cotranscribed in many land plants including lettuce . The complete chloroplast genome of Lactuca sativa is 152,772 bp in length .

The organization of genes in this region follows a specific pattern:

• ndhC and ndhK genes are partially overlapped and cotranscribed

• The downstream ndhK mRNA possesses multiple possible AUG initiation codons

• The ndhC-trnV spacer region shows higher sequence divergence compared to other chloroplast regions, making it useful for species-level phylogenetics

To study this gene organization, researchers typically use PCR-based markers and sequencing. The ndhC-trnV region in particular has been identified as one of the fast-evolving DNA sequences useful for species-level phylogenetics in Asteraceae .

What expression patterns characterize ndhC in different physiological states?

Key expression patterns observed in research:

Methodologically, researchers track these expression patterns using:

• qRT-PCR to quantify transcript abundance

• Northern blot analysis for transcript size verification

• Western blot for protein level determination

• In vitro translation systems to study protein synthesis efficiency

Studies of hydrogen peroxide-mediated signaling show that chloroplastic ndh genes respond to oxidative stress through mechanisms involving both rapid translation of pre-existing transcripts and increased transcript levels .

How does the ndhC gene in Lactuca sativa compare evolutionarily to homologs in other Asteraceae?

Comparative genomic analysis of ndhC between Lactuca sativa and other Asteraceae members reveals important evolutionary insights. When comparing the chloroplast genomes of Lactuca sativa (lettuce) and Helianthus annuus (sunflower), which belong to different subfamilies (Cichorioideae and Asteroideae respectively), researchers have found both conserved and divergent features.

Evolutionary comparisons reveal:

• The ndhC gene sequence shows moderate conservation across Asteraceae

• The ndhC-trnV spacer region exhibits higher variability and is useful for phylogenetic studies

• Both lettuce and sunflower chloroplast genomes contain two inversions relative to tobacco: a large 22.8-kb inversion and a smaller 3.3-kb inversion nested within it

Research methodology for evolutionary studies typically involves:

• Multiple sequence alignment of ndhC genes and flanking regions

• Phylogenetic tree construction using maximum likelihood or Bayesian approaches

• Calculation of synonymous and non-synonymous substitution rates

• Analysis of selective pressures on different regions of the gene

The comparative analysis between Lactuca and Helianthus has contributed to a broader understanding of plastid evolution across flowering plants and identified the ndhC-trnV spacer as one of the fast-evolving regions useful for species-level phylogenetics in Asteraceae .

What mechanisms control translational coupling between ndhC and ndhK genes?

The overlapping gene arrangement of ndhC and ndhK in lettuce chloroplasts presents a fascinating case of translational regulation. Research has revealed specialized mechanisms ensuring proper stoichiometry between these protein subunits.

Translation of the downstream ndhK gene depends on termination of the preceding ndhC cistron, demonstrating translational coupling. Experimental evidence shows that:

• The major initiation site of tobacco ndhK mRNAs is the third AUG located 4 nt upstream from the ndhC stop codon

• Mutation of the ndhC stop codon (UAG) arrests translation of the ndhK cistron

• Frameshift of the ndhC coding strand inhibits translation of the distal cistron

• Surprisingly, removal of the ndhC 5′-UTR and its AUG still supports substantial translation of the ndhK cistron, but this translation is abolished by removing the ndhC stop codon

An interesting finding is that unlike most overlapping mRNAs where downstream cistron translation is very low, the ndhC/K mRNA produces NdhK and NdhC in similar amounts. To achieve the 1:1 stoichiometry required based on bacterial complex I structure, translation occurs through both a translational coupling event and a termination codon-dependent pathway .

Research methodologies to study this mechanism include:

• In vitro translation systems from chloroplasts

• Site-directed mutagenesis of initiation and termination codons

• Protein quantification using western blotting

• Ribosome profiling to track translation efficiency

How do environmental stressors affect ndhC expression and function?

Environmental stressors significantly modulate ndhC expression and function in Lactuca sativa, with the protein playing a crucial role in plant stress responses. Several studies have documented how different stress conditions affect this gene.

Effect of different stressors on ndhC expression:

Research has demonstrated that hydrogen peroxide mediates the induction of the chloroplastic Ndh complex under photooxidative stress. In barley leaves, H₂O₂ treatment under growing light mimicked photooxidative stimulus, causing a dose-dependent increase of NADH-DH activity and NDH-F polypeptide levels. This induction involves both rapid translation of pre-existing transcripts and increased ndh transcript levels .

Methodological approaches to study these effects include:

• Exposing plants to controlled stress conditions in growth chambers

• Measuring transcript levels via qPCR

• Assessing protein accumulation through western blotting

• Analyzing NADH dehydrogenase activity using enzymatic assays

• Using H₂O₂-scavengers like dimethyltiourea to confirm signaling pathways

What recombination and mutation events affect the ndhC gene in Lactuca sativa?

The ndhC gene in Lactuca sativa undergoes various recombination and mutation events that influence its evolution and function. Research on gene clusters in lettuce has provided insights into these genetic mechanisms.

Studies examining recombination and spontaneous mutation events within clusters of resistance genes in lettuce have revealed that:

• The recombination frequency in certain regions is significantly lower than the genome average (18-fold lower in the Dm3 region)

• Recombinants are identified only rarely within gene clusters

• Spontaneous mutation rates can reach 10⁻³ to 10⁻⁴ per generation

• Most mutations are associated with large chromosome deletions

• When recombination can be analyzed, deletion events are often associated with exchange of flanking markers, consistent with unequal crossing over

• Gene conversion events can generate novel chimeric genes

These findings suggest that the short-term evolution of gene clusters in lettuce involves several genetic mechanisms including unequal crossing over and gene conversion. While these studies focused on resistance genes, similar mechanisms likely apply to other gene regions including those containing ndhC.

Methodological approaches to study recombination and mutation include:

• PCR-based markers to screen multiple generations for recombinants

• Sequence analysis to detect deletions and gene conversion events

• Population screening for spontaneous mutations

• Analysis of flanking markers to determine recombination events

How can recombinant ndhC protein be used to study NDH complex assembly?

Recombinant Lactuca sativa NAD(P)H-quinone oxidoreductase subunit 3 provides a valuable tool for investigating NDH complex assembly and function. The available recombinant protein is typically produced with specific characteristics to facilitate research applications.

Specifications of recombinant ndhC protein:

• Full length protein spanning amino acids 1-120

• Sequence: MFLLYEYDIFWAFLIISSLIPILVFFISGFLAPISKGPEKLSSYESGIEPIGDAWLQFRIRYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFVEALIFVLILIVGLVYAWRKGALEWS

• Expression typically includes a tag (determined during production process)

• Storage in Tris-based buffer with 50% glycerol

Research applications for the recombinant protein include:

• In vitro reconstitution of NDH complex components

• Protein-protein interaction studies to map subunit relationships

• Antibody production for immunolocalization experiments

• Structural studies of membrane protein integration

• Enzymatic assays to assess function and electron transport capabilities

Methodologically, researchers can use the recombinant protein in:

• Pull-down assays to identify interaction partners

• Activity assays to measure electron transport rates

• Crystallization trials for structural determination

• Proteoliposome reconstitution to study membrane integration

• Cross-linking experiments to map proximity relationships between subunits

What approaches are effective for studying ndhC involvement in photoprotection mechanisms?

The ndhC gene product plays a crucial role in photoprotection mechanisms in Lactuca sativa, particularly under stress conditions. Several sophisticated approaches have proven effective for investigating this role.

Effective research methodologies include:

• Chlorophyll fluorescence analysis

  • Measures PSII quantum yield (Fv/Fm) and non-photochemical quenching (NPQ)

  • Allows real-time assessment of photosynthetic performance under stress

  • Can be combined with inhibitors to isolate NDH complex contribution

• Hydrogen peroxide signaling pathway investigation

  • Treatment with H₂O₂ under controlled light conditions

  • Use of scavengers like dimethyltiourea to block H₂O₂ signaling

  • Measurement of NADH-DH activity and NDH polypeptide levels

• Transcriptional and translational regulation analysis

  • qRT-PCR to track transcript dynamics during stress response

  • Analysis of rapid translation of pre-existing transcripts

  • Study of increased transcript levels under stress conditions

• Physiological and biochemical stress response measurements

  • Assessment of plant growth parameters under stress

  • Measurement of antioxidant enzyme activities

  • Determination of lipid peroxidation levels and membrane integrity

Research has shown that expression of ndhC and other ndh genes increases under photooxidative stress, with H₂O₂ serving as a signaling molecule. In barley, treatments with H₂O₂ under growing light mimicked photooxidative stimulus, causing a dose-dependent increase in NDH complex components. This induction involved mechanisms that included both rapid translation of pre-existing transcripts and increased transcript levels .

How can genomic analysis of ndhC contribute to phylogenetic studies of Asteraceae?

The ndhC gene and its flanking regions offer valuable phylogenetic markers for studying evolutionary relationships within Asteraceae. Comprehensive genomic analysis of this region can provide significant insights into the family's evolutionary history.

Key approaches for phylogenetic applications include:

• Comparative analysis of ndhC-trnV spacers

  • This region shows higher sequence divergence compared to other chloroplast regions

  • Has been identified as one of the fast-evolving DNA sequences useful for species-level phylogenetics

  • Analysis typically involves PCR amplification followed by sequencing

• Whole plastid genome comparisons

  • Complete chloroplast genomes of Lactuca sativa (152,772 bp) and Helianthus annuus (151,104 bp) reveal family-wide patterns

  • Both genomes share two inversions: a large 22.8-kb inversion and a smaller 3.3-kb inversion nested within it

  • Comparison across Asteraceae members helps establish evolutionary relationships

• Analysis of selective pressures

  • Calculation of synonymous vs. non-synonymous substitution rates

  • Identification of positively selected sites within the ndhC coding region

  • Assessment of purifying selection indicating functional constraints

• Shared repeat analysis and categorization

  • Seven classes of repeats have been identified in Asteraceae chloroplast genomes: double tandem repeats, three or more tandem repeats, direct repeats dispersed in the genome, repeats in reverse complement orientation, hairpin loops, runs of A's or T's exceeding 12 bp, and gene or tRNA similarity

These analyses contribute to understanding the broader patterns of plastid evolution across flowering plants and help resolve relationships within Asteraceae, the second largest family of plants with over 20,000 species .

What are the optimal conditions for handling recombinant ndhC protein?

Working with recombinant Lactuca sativa NAD(P)H-quinone oxidoreductase subunit 3 requires specific handling conditions to maintain protein stability and functionality. Based on manufacturer protocols, the following conditions are recommended:

When designing experiments with this recombinant protein, researchers should consider:

• Working with small aliquots to avoid repeated freeze-thaw cycles

• Using appropriate controls when performing activity assays

• Maintaining proper temperature conditions during all experimental procedures

• Considering the presence of any tags that might affect protein function or interactions

How can researchers effectively investigate ndhC gene expression under stress conditions?

Investigating ndhC gene expression under various stress conditions requires a multi-faceted approach combining molecular, biochemical, and physiological techniques. The following methodological framework has proven effective:

• Experimental design considerations:

  • Use controlled growth conditions (temperature 25/15°C, photoperiod 16/8 h day/night)

  • Maintain consistent relative humidity (60-80%)

  • Apply photosynthetically active radiation at ~350 μmol m⁻² s⁻¹

  • Include appropriate controls for each stress treatment

• Stress application protocols:

  • For photooxidative stress: Expose plants to high light intensity

  • For oxidative stress: Apply H₂O₂ at various concentrations

  • For heavy metal stress: Use defined concentrations of Pb or Ag (e.g., 25-75 mg/kg for Ag, 180-540 mg/kg for Pb)

  • For physical stressors: Modify temperature, water availability, or nutrient status

• Expression analysis methodology:

  • Transcript quantification: Use qRT-PCR with gene-specific primers

  • Protein detection: Western blot with antibodies against ndhC

  • Activity assessment: Measure NADH dehydrogenase activity spectrophotometrically

  • Temporal dynamics: Sample at multiple time points (e.g., 4h, 16h) to capture both early and late responses

• Physiological correlates:

  • Monitor plant growth parameters

  • Assess photosynthetic efficiency using chlorophyll fluorescence

  • Measure reactive oxygen species levels

  • Analyze anatomical alterations using microscopy