Recombinant Lactuca sativa NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Lactuca sativa (Garden lettuce)
Target Names
ndhE
Target Protein Sequence
MMLEHVLVLSAYLFSVGLYGLITSRNMVRALMCLELILNAVNLNFVTFSDFFDSRQLKGA IFSIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSNLLNK
Uniprot No.

Target Background

Function
NDH (NAD(P)H dehydrogenase) facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is thought to be plastoquinone. The enzyme couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Database Links

KEGG: lsv:3772855

Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant ndhE production in lettuce?

The Tsukuba system vector has demonstrated significant efficacy for transient expression of recombinant proteins in lettuce. This system, when optimized with RNA interference (RNAi) constructs targeting gene silencing mechanisms, can substantially enhance recombinant protein yields in Lactuca sativa. Recent research has shown that co-expression of RNAi constructs targeting LsRDR1 and LsRDR6 with the desired recombinant protein can increase expression levels by approximately 4.9-fold at 3 days post-infiltration and 3.7-fold at 5 days post-infiltration compared to controls .

For optimal expression of chloroplast proteins like ndhE, targeting the gene silencing mechanism is particularly important as chloroplast-based production systems have been confirmed to be more promising than nuclear-based systems in photosynthetic organisms. When designing expression vectors for ndhE, researchers should consider:

  • Vector elements that minimize post-transcriptional gene silencing

  • Appropriate promoter selection for chloroplastic proteins

  • Codon optimization specific to lettuce chloroplast expression

The expression efficiency may vary between lettuce varieties, with research demonstrating different expression levels between Salinas lettuce and commercial lettuce varieties, showing approximately 2.4-fold and 2.33-fold increases at 3 and 5 days post-infiltration, respectively .

What are the primary challenges in expressing and purifying recombinant ndhE from lettuce?

Expressing chloroplastic proteins like ndhE in recombinant systems presents several methodological challenges:

  • Gene silencing mechanisms: Lettuce naturally employs RNA-dependent RNA polymerases (RDRs) that can significantly reduce heterologous gene expression. Specifically, LsRDR1 and LsRDR6 have been identified as major contributors to the silencing of foreign genes in lettuce .

  • Protein stability issues: As a chloroplastic protein, ndhE requires specific conditions for proper folding and stability. The native environment of the chloroplast provides co-factors and interaction partners that may be absent in recombinant systems.

  • Purification challenges: Membrane-associated proteins like ndhE, which functions within the NAD(P)H-quinone oxidoreductase complex, can be difficult to extract and purify while maintaining native conformation.

  • Variable expression across lettuce varieties: Research has shown significant differences in recombinant protein expression between lettuce varieties, with Salinas lettuce showing higher expression potential than some commercial varieties .

To address these challenges, researchers have developed strategies such as targeted RNAi approaches that can simultaneously knock down multiple gene silencing components. Quantitative transcription analysis has demonstrated that RNAi constructs targeting common regions of LsRDR1 and LsRDR6 with 75-76% similarity can effectively reduce gene silencing activity and enhance recombinant protein production .

How do antioxidant properties of lettuce affect recombinant protein stability?

Lettuce varieties contain significant levels of antioxidant compounds that may impact recombinant protein stability during expression and purification processes. Research on lettuce has shown:

  • Polyphenol content: Leaf extracts of lettuce demonstrate significant DPPH radical-scavenging activity with an IC50 value of 0.11 mg/mL, while seed extracts show an IC50 value of 0.21 mg/mL .

  • Differential antioxidant profiles: Seed extracts exhibit stronger ABTS radical-scavenging activity (IC50 of 1.24 mg/mL) compared to leaf extracts (IC50 of 5.34 mg/mL) .

  • Polyphenolic compounds: Lettuce contains various polyphenols including caftaric acid, chlorogenic acid, and chicoric acid, with higher concentrations generally found in seed extracts .

The antioxidant capacity measured by ABTS assay correlates strongly with polyphenolic content, while DPPH radical scavenging activity appears more related to the position of hydroxyl groups in flavonoid aromatic rings rather than their total number . Researchers working with recombinant ndhE should consider these factors when selecting the most appropriate lettuce tissue (leaf vs. seed) and variety for their specific expression requirements.

What methodological approaches can overcome gene silencing during ndhE expression?

Overcoming gene silencing is critical for achieving high yields of recombinant ndhE in lettuce. Advanced methodological approaches include:

RNAi-Based Silencing of Silencing Mechanisms:
Recent research has demonstrated the effectiveness of targeting multiple RNA-dependent RNA polymerases simultaneously. Two RNAi constructs (RNAi-1 and RNAi-2) targeting common regions of LsRDR1 and LsRDR6 with 75% and 76% similarity, respectively, have been evaluated for simultaneous gene silencing . Quantitative analysis revealed:

RNAi ConstructLsRDR1 KnockdownLsRDR6 KnockdownLsRDR2 KnockdownProtein Yield Increase
RNAi-1EffectiveEffectiveNot observed4.9-fold (3 dpi)
RNAi-2EffectiveEffectiveNot observedLower than RNAi-1

Both constructs effectively knocked down target genes at 3 and 5 days post-infiltration (dpi), with RNAi-1 exhibiting slightly higher efficiency .

Optimized Co-Expression Strategies:
When co-infiltrating RNAi constructs with the gene of interest, timing is crucial. Experiments with enhanced green fluorescent protein (EGFP) showed:

  • 4.9-fold increase at 3 dpi with RNAi-1

  • 3.7-fold increase at 5 dpi with RNAi-1

This suggests that early harvest may be optimal for maximum yield of recombinant proteins like ndhE.

Validation with Multiple Proteins:
The approach has been validated with different proteins beyond EGFP. Co-infiltration with Bet v 1 (a major allergen from birch pollen) resulted in a 2.5-fold increase in expression in Salinas lettuce at 5 dpi . This demonstrates the versatility of the approach for different protein targets, suggesting it would be applicable to ndhE expression.

For ndhE specifically, researchers should consider designing RNAi constructs that target the most active silencing mechanisms in their specific lettuce variety, while also optimizing harvest timing to capture peak expression levels.

How can researchers optimize chloroplast targeting for enhanced ndhE expression?

Optimizing chloroplast targeting for ndhE expression requires sophisticated strategies:

Transit Peptide Selection and Engineering:
Since ndhE is naturally chloroplast-encoded, recombinant expression from the nuclear genome requires efficient transit peptides. Researchers should consider:

  • Using native lettuce chloroplast transit peptides for optimal compatibility

  • Testing synthetic transit peptides with enhanced cleavage efficiency

  • Comparing sequence-optimized variants to identify the most efficient targeting signal

Chloroplast Transformation Alternatives:
Direct chloroplast transformation, though technically challenging in lettuce, may offer advantages for ndhE expression:

  • Natural compartmentalization in the target organelle

  • Higher copy number due to multiple chloroplasts per cell

  • Absence of glycosylation in chloroplasts (beneficial if native ndhE is non-glycosylated)

While direct lettuce chloroplast transformation protocols are still being optimized, research in other systems suggests that leveraging replicative elements from viruses can enhance heterologous gene expression . Similar approaches could potentially be adapted for lettuce chloroplast transformation.

Protein Stabilization Strategies:
For membrane-associated proteins like ndhE, co-expression with stabilizing factors may improve yield and functionality:

  • Partner proteins from the NAD(P)H dehydrogenase complex

  • Molecular chaperones specific to chloroplast protein folding

  • Membrane-mimetic agents during extraction and purification

These strategies must be empirically tested for ndhE, as the optimal approach may vary based on specific protein characteristics and experimental goals.

How do different lettuce varieties impact recombinant ndhE expression efficiency?

Lettuce variety selection significantly impacts recombinant protein expression, including potential ndhE production. Comparative analysis reveals:

Lettuce VarietyProtein Expression IncreaseAntioxidant PropertiesSecondary Metabolites
Salinas4.9-fold (3 dpi), 3.7-fold (5 dpi)Not reportedNot reported
Commercial lettuce2.4-fold (3 dpi), 2.33-fold (5 dpi)Not reportedNot reported
Green romaineNot reported for protein expressionHigh lactucin (1071.67 μg/g extract)Higher polyphenols in seeds
Red romaineNot reported for protein expressionModerate lactucin (361.50 μg/g extract)Variable polyphenol content

The significant difference in protein expression between Salinas and commercial lettuce varieties (approximately 2-fold) highlights the importance of variety selection . For ndhE expression specifically, researchers should consider:

  • Genetic factors: Different varieties may have varying levels of endogenous gene silencing activity

  • Metabolic background: Secondary metabolites may interact with recombinant protein production

  • Tissue-specific differences: Seed vs. leaf expression systems show different properties

Green romaine lettuce contains significantly higher levels of lactucin than other varieties , which may indicate different metabolic profiles that could affect recombinant protein expression. While these studies didn't specifically examine ndhE, they suggest that systematic screening of lettuce varieties would be valuable for optimizing ndhE expression.

Researchers should conduct pilot studies across multiple lettuce varieties to identify the optimal host for their specific ndhE expression requirements, considering both yield and functional parameters.

What analytical methods are most effective for confirming correct folding and function of recombinant ndhE?

Verifying proper folding and function of recombinant ndhE requires a multi-faceted analytical approach:

Structural Analysis Techniques:

  • Circular dichroism (CD) spectroscopy to assess secondary structure elements

  • Limited proteolysis followed by mass spectrometry to probe tertiary structure

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) to verify oligomeric state

Functional Assays:
As an NAD(P)H-quinone oxidoreductase subunit, functional analysis should include:

  • NAD(P)H oxidation assays using spectrophotometric methods

  • Electron transfer measurements with artificial electron acceptors

  • Integration assays with other NDH complex components

Membrane Association Analysis:
Since ndhE is a chloroplast membrane protein:

  • Membrane fraction analysis by ultracentrifugation

  • Detergent solubilization optimization studies

  • Lipid reconstitution experiments to verify membrane integration

Comparative Analysis:
When possible, comparison with native ndhE provides valuable validation:

  • Immunological detection using antibodies against conserved epitopes

  • Activity comparison with isolated chloroplast fractions

  • Mass spectrometry-based structural comparison

These analytical approaches should be applied systematically to ensure that recombinant ndhE not only accumulates in lettuce expression systems but also adopts its native conformation and maintains functional capabilities.

How can researchers mitigate oxidative stress during ndhE expression and purification?

Oxidative stress during recombinant protein expression can compromise yield and quality, particularly for electron transport proteins like ndhE. Strategic approaches include:

Leveraging Lettuce's Antioxidant Properties:
Lettuce naturally contains antioxidant compounds that can protect recombinant proteins:

  • Leaf extracts show strong DPPH radical-scavenging activity (IC50: 0.11 mg/mL)

  • Seed extracts demonstrate effective ABTS radical-scavenging (IC50: 1.24 mg/mL)

The choice between leaf and seed expression systems should consider these differential antioxidant profiles. Seed extracts contain higher levels of polyphenols including caftaric acid, chlorogenic acid, and chicoric acid, which may provide enhanced protection during extraction .

Extraction and Purification Optimization:

  • Include reducing agents appropriate for membrane proteins (e.g., DTT, β-mercaptoethanol)

  • Employ oxygen-free environments during critical purification steps

  • Add specific antioxidants based on lettuce variety antioxidant profiles

Expression Timing Considerations:
The optimal harvest time affects not only protein yield but also exposure to oxidative stress:

  • At 3 dpi, protein yields are typically higher (4.9-fold increase with RNAi-1)

  • At 5 dpi, yields decrease slightly (3.7-fold increase with RNAi-1)

This suggests that extended expression periods may increase oxidative damage, recommending earlier harvest for optimal ndhE quality.

What are the critical parameters for scaling up ndhE production in lettuce expression systems?

Scaling up recombinant ndhE production requires attention to several critical parameters:

Optimization of Gene Silencing Suppression:
As production scale increases, consistent suppression of gene silencing becomes crucial:

  • RNAi constructs must be optimized for large-scale delivery

  • Co-infiltration ratios between RNAi and ndhE constructs may require adjustment

  • Validation of silencing efficiency across larger plant populations

Agrobacterium Delivery Optimization:
For transient expression systems:

  • Standardize bacterial culture conditions for consistent transformation

  • Optimize infiltration medium composition and pH

  • Develop mechanical infiltration methods suitable for larger plant numbers

Harvest Timing Strategy:
Based on expression kinetics data:

  • Implement precise harvest scheduling (optimal at 3 dpi for maximum yield)

  • Develop rapid processing capabilities to minimize post-harvest degradation

  • Consider staggered planting and infiltration to maintain continuous production

Extraction and Purification Scaling:
For membrane proteins like ndhE:

  • Optimize detergent types and concentrations for efficient extraction

  • Develop continuous or semi-continuous purification processes

  • Implement quality control checkpoints throughout the purification process

Systematic optimization of these parameters will facilitate transition from laboratory-scale expression to larger production volumes while maintaining protein quality and yield.

What are the most promising research directions for improving recombinant ndhE production?

Based on current research findings, several promising directions emerge for enhancing recombinant ndhE production in lettuce:

  • Advanced gene silencing suppression: Developing next-generation RNAi constructs targeting multiple components of the gene silencing machinery simultaneously. Current research demonstrates that targeting LsRDR1 and LsRDR6 with a single construct can enhance protein expression by up to 4.9-fold .

  • Lettuce variety engineering: Creating specialized lettuce lines with reduced gene silencing capacity and enhanced expression of molecular chaperones relevant to chloroplast membrane proteins.

  • Hybrid expression systems: Combining transient expression with viral replicon elements to achieve higher copy numbers and expression levels, similar to approaches being developed in other plant systems .

  • Metabolic engineering: Modifying lettuce antioxidant pathways to create an optimized cellular environment for ndhE expression, leveraging the natural antioxidant properties of lettuce varieties .

  • Direct chloroplast transformation: Advancing protocols for direct transformation of lettuce chloroplasts, potentially eliminating the need for transit peptides and nuclear-to-chloroplast targeting.

These research directions represent systematic approaches to address the current limitations in recombinant ndhE production, with the potential to significantly advance both fundamental understanding and practical applications in this field.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.