Recombinant Lactuca sativa Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Lactuca sativa psbB is produced in E. coli with an N-terminal His tag, enabling high-purity isolation via affinity chromatography. Key specifications include:

ParameterDetails
SourceLactuca sativa (Garden lettuce)
Expression SystemE. coli
Protein Length508 amino acids (Full-length)
Molecular Weight~55 kDa (theoretical)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Sequence Features:

  • Binds 16 chlorophyll a molecules and β-carotene, critical for light harvesting .

  • Contains six transmembrane α-helices, forming a scaffold for PSII assembly .

Biological Function in Photosystem II

CP47 is integral to PSII’s structure and function:

  • Light Absorption: Acts as an inner antenna, transferring energy to the PSII reaction center .

  • Structural Role: Stabilizes the D1/D2 heterodimer and Mn₄CaO₅ cluster for water oxidation .

  • Electron Transport: Facilitates electron transfer from water-splitting to plastoquinone .

3.1. In Vitro Studies

  • Photosynthesis Research: Used to study PSII assembly intermediates and chlorophyll-protein interactions .

  • Antibody Development: A global polyclonal antibody (AS04 038) targets conserved psbB epitopes, enabling detection across plants, algae, and cyanobacteria .

3.2. Biotechnological Innovations

  • Edible Vaccine Platforms: Lettuce chloroplasts have been engineered to express therapeutic proteins (e.g., cholera toxin B–proinsulin fusion), demonstrating the potential for oral drug delivery .

  • Chloroplast Genome Editing: Base editors (DdCBEs) targeting psbB in lettuce achieved C-to-T mutations with efficiencies up to 4.1%, enabling trait engineering .

4.1. Comparative Analysis with Homologs

FeatureLactuca sativa psbB Oryza sativa psbB
Amino Acid SequenceUnique residues at positions 329–335Divergent C-terminal motifs
Chlorophyll Binding16 molecules 16 molecules
Expression Yield~2.5% TSP in chloroplasts Higher in E. coli

4.2. Spectroscopic Properties

  • Absorption Peaks: 437 nm (chlorophyll a) and 670–680 nm (Q<sub>Y</sub> transition) .

  • Fluorescence Emission: Blue-shifted at 77 K compared to spinach CP47, suggesting subtle conformational differences .

5.1. Optimization Strategies

  • Codon Usage: Lettuce chloroplast vectors utilize native psbA 5′ UTR for high-yield expression .

  • Fusion Tags: His tag facilitates nickel-affinity purification, achieving >90% purity .

Future Directions

  • Therapeutic Production: Lettuce-based systems could scale low-cost vaccines (e.g., SARS-CoV-2 RBD-CTxB) .

  • Photosynthesis Engineering: Editing psbB via DdCBEs may enhance PSII efficiency under stress .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Lactuca sativa (Garden lettuce)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFSDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPSWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPVTVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQIG
Uniprot No.

Target Background

Function
CP47, a core component of Photosystem II (PSII), plays a crucial role in chlorophyll binding and catalyzing the primary light-induced photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H2O, generating O2 and a proton gradient that subsequently drives ATP formation.
Database Links

KEGG: lsv:3772835

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem II CP47 chlorophyll apoprotein and what role does it play in photosynthesis?

The Photosystem II CP47 chlorophyll apoprotein is a key protein component of the photosynthetic apparatus. It functions primarily in binding chlorophyll molecules and is hypothesized to be involved in binding the reaction center chlorophyll specifically . This protein serves as an internal antenna that helps capture light energy and transfer it to the reaction center of Photosystem II. The CP47 protein (encoded by the psbB gene) is essential for the assembly and stability of the Photosystem II complex, a crucial component of the photosynthetic electron transport chain responsible for water oxidation and oxygen evolution.

How conserved is the psbB gene across different photosynthetic organisms?

The psbB gene shows significant conservation across different photosynthetic species, indicating its evolutionary importance. Comparative analyses between cyanobacterial and plant psbB genes reveal substantial homology. For example, the DNA sequence of the psbB gene from the cyanobacterium Synechocystis 6803 shows 68% homology with that from spinach, while the predicted amino acid sequence shares 76% homology . This high degree of conservation suggests that the protein structure and function have been maintained throughout evolution from prokaryotic to eukaryotic photosynthetic organisms. The hydropathy patterns between different species are almost indistinguishable, indicating that the general folding pattern of CP47 in the thylakoid membrane is highly conserved across species .

What are the structural characteristics of the CP47 protein that make it important for chlorophyll binding?

The CP47 protein contains several key structural features that facilitate its chlorophyll-binding function:

  • Hydrophobic transmembrane domains: The protein contains multiple membrane-spanning regions that anchor it within the thylakoid membrane.

  • Histidine pairs: CP47 contains five pairs of histidine residues that are spaced by 13 or 14 amino acids and are located in hydrophobic regions of the protein. These histidine residues are hypothesized to be involved in chlorophyll binding .

  • Conserved folding pattern: The hydropathy patterns of CP47 from different species (such as Synechocystis and spinach) are nearly identical, suggesting that the three-dimensional folding of the protein in the membrane is crucial for its function .

These structural elements work together to position chlorophyll molecules optimally for light harvesting and energy transfer within the Photosystem II complex.

How does genetic modification of specific histidine residues in CP47 affect chlorophyll binding and Photosystem II function?

Genetic modification of the histidine residues in CP47 can significantly impact chlorophyll binding and consequently Photosystem II function. Research has identified five pairs of histidine residues spaced by 13-14 amino acids in hydrophobic regions that are likely candidates for chlorophyll binding . When these specific histidine residues are mutated, researchers typically observe:

  • Altered chlorophyll binding affinity and orientation

  • Changes in energy transfer efficiency between chlorophyll molecules

  • Modified spectroscopic properties of the Photosystem II complex

  • Potential destabilization of the entire Photosystem II structure

Experimental approaches to investigate these effects include site-directed mutagenesis of the recombinant psbB gene, followed by protein expression and reconstitution studies. Functional analyses using chlorophyll fluorescence measurements, oxygen evolution assays, and electron transport rate determinations can quantify the impact of these mutations. Complete disruption of the psbB gene has been shown to result in loss of Photosystem II activity, highlighting the protein's essential nature .

What are the differences in post-translational modifications between native and recombinant Lactuca sativa CP47 protein?

Post-translational modifications (PTMs) can differ significantly between native CP47 isolated from Lactuca sativa chloroplasts and recombinant protein expressed in heterologous systems like E. coli . Key differences include:

Modification TypeNative CP47Recombinant CP47 (E. coli)Functional Impact
PhosphorylationPresent at multiple serine/threonine residuesTypically absent or reducedAffects regulation of protein turnover and repair cycle
GlycosylationMinimal if anyAbsentMay impact protein stability in solution
Oxidative modificationsPresent (age-dependent)MinimalInfluences protein longevity and function
Chlorophyll attachmentComplete, enzymatically assistedIncomplete, requires reconstitutionDirectly affects light-harvesting capability

These differences necessitate careful consideration when using recombinant CP47 for structural or functional studies. Researchers often need to employ in vitro reconstitution methods to attach chlorophyll molecules to recombinant CP47 or develop expression systems that can perform the necessary post-translational modifications.

How does the structure-function relationship of CP47 differ between cyanobacteria and higher plants like Lactuca sativa?

While the CP47 protein shows high sequence homology between cyanobacteria and higher plants (76% amino acid homology between Synechocystis and spinach) , there are important differences in structure-function relationships:

  • Loop regions: Higher plants like Lactuca sativa typically have extended loop regions connecting the transmembrane helices, which may provide additional regulatory sites or interaction surfaces.

  • Environmental adaptation: The CP47 protein in higher plants has evolved to function within the structured environment of thylakoid membranes in chloroplasts, whereas cyanobacterial CP47 operates in a more direct cellular context.

  • Protein-protein interactions: The interaction network of CP47 with other photosystem components is more complex in higher plants, involving both nuclear and chloroplast-encoded proteins.

  • Regulatory mechanisms: Higher plants employ more sophisticated regulatory mechanisms for photosystem assembly and repair, which influence CP47 function.

These differences should be considered when extrapolating findings from cyanobacterial studies to Lactuca sativa or when using recombinant lettuce CP47 in experimental systems.

What expression systems are optimal for producing functional recombinant Lactuca sativa CP47 protein?

The choice of expression system significantly impacts the yield, folding, and functionality of recombinant Lactuca sativa CP47 protein. Based on current methodologies:

Expression SystemAdvantagesLimitationsYieldFunctionality
E. coliSimple, rapid, cost-effectiveLimited post-translational modifications, inclusion body formationHigh (with optimization)Requires refolding and reconstitution
Cyanobacterial hostsNatural photosynthetic machinery, better foldingSlower growth, more complex genetic manipulationModerateHigher natural functionality
Plant-based expressionMost authentic processing and foldingTime-consuming, lower yieldsLow-moderateHighest natural functionality
Cell-free systemsAvoids toxicity issues, rapidExpensive, smaller scaleLowDependent on supplemented components

What reconstitution methods are most effective for incorporating chlorophyll molecules into recombinant CP47?

Effective reconstitution of chlorophyll molecules into recombinant CP47 protein requires careful consideration of multiple factors:

  • Chlorophyll preparation:

    • Use freshly extracted chlorophyll a and b from plant material

    • Maintain anaerobic conditions to prevent oxidation

    • Verify purity using absorption spectroscopy

  • Protein preparation:

    • Ensure proper folding of recombinant CP47

    • Remove denaturants completely if refolding was performed

    • Stabilize the protein in appropriate detergent micelles

  • Reconstitution procedure:

    • Gradually combine chlorophyll with protein at specific molar ratios

    • Perform the reconstitution at controlled temperature (typically 4-10°C)

    • Allow sufficient incubation time for binding equilibrium (4-24 hours)

    • Remove unbound chlorophyll through gentle chromatography

  • Verification of successful reconstitution:

    • Absorption spectroscopy to confirm chlorophyll binding

    • Circular dichroism to assess protein folding

    • Fluorescence measurements to verify energy transfer capability

The success of reconstitution can be evaluated by comparing the spectroscopic properties of the reconstituted complex with those of the native protein isolated from Lactuca sativa thylakoids.

What analytical techniques provide the most accurate assessment of CP47-chlorophyll binding?

Multiple complementary analytical techniques can be employed to accurately assess CP47-chlorophyll binding:

TechniqueInformation ProvidedAdvantagesLimitations
Absorption SpectroscopyChlorophyll binding stoichiometry, environmentQuick, non-destructiveLimited structural detail
Fluorescence SpectroscopyEnergy transfer efficiency, chlorophyll orientationHighly sensitive, functional informationIndirect structural information
Circular DichroismProtein secondary structure, chlorophyll arrangementSensitive to conformational changesLower resolution than crystallography
Time-resolved SpectroscopyEnergy transfer kineticsDetailed functional informationComplex data interpretation
Mass SpectrometryBinding sites, stoichiometryPrecise mass determinationSample preparation challenges
X-ray CrystallographyAtomic-level structureHighest resolutionDifficult for membrane proteins
Cryo-electron MicroscopyNear-atomic resolution structureWorks with smaller samples than X-raySample preparation challenges

A comprehensive approach combining multiple techniques provides the most accurate assessment. For example, researchers might use absorption and fluorescence spectroscopy for initial characterization, followed by more detailed structural analysis using cryo-electron microscopy or X-ray crystallography if facilities are available.

How can researchers differentiate between functional and non-functional recombinant CP47 protein?

Distinguishing between functional and non-functional recombinant CP47 requires assessment of multiple parameters:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to verify secondary structure

    • Size-exclusion chromatography to confirm proper oligomeric state

    • Protease sensitivity pattern compared to native protein

  • Chlorophyll binding capacity:

    • Quantitative chlorophyll binding assays

    • Spectroscopic analysis of bound chlorophyll

    • Fluorescence resonance energy transfer (FRET) measurements

  • Functional assays:

    • Reconstitution with other Photosystem II components

    • Oxygen evolution measurements in reconstituted systems

    • Electron transport capability assessment

  • Control experiments:

    • Comparison with native CP47 isolated from Lactuca sativa

    • Inclusion of known non-functional mutants as negative controls

    • Use of related functional proteins from other species as reference points

Combining these approaches provides comprehensive evaluation of recombinant protein functionality. When interpreting results, researchers should consider that partial functionality may be observed depending on which aspects of the protein structure are properly maintained in the recombinant form.

What are the most common pitfalls in experimental design when studying interactions between CP47 and other Photosystem II components?

Common experimental pitfalls and recommendations for studying CP47 interactions include:

  • Detergent interference:

    • Pitfall: Inappropriate detergent choice can disrupt native protein-protein interactions

    • Solution: Screen multiple detergents at minimal effective concentrations; consider native nanodiscs or styrene maleic acid lipid particles (SMALPs) for extraction

  • Orientation constraints:

    • Pitfall: Incorrect orientation of immobilized proteins for interaction studies

    • Solution: Use oriented proteoliposomes or nanodiscs with controlled protein insertion

  • Incomplete photosystem components:

    • Pitfall: Missing accessory proteins that facilitate or stabilize interactions

    • Solution: Include all relevant components in reconstitution experiments

  • Non-physiological conditions:

    • Pitfall: Buffer conditions that don't reflect thylakoid lumen/stroma environments

    • Solution: Mimic physiological pH gradients and ion concentrations

  • Data interpretation challenges:

    • Pitfall: Attributing observed effects solely to CP47 when multiple factors may be involved

    • Solution: Use appropriate controls and CP47 variants with specific mutations

Careful consideration of these factors during experimental design will improve data quality and interpretability when studying the complex interaction network of CP47 within Photosystem II.

How can researchers effectively incorporate recombinant Lactuca sativa CP47 into artificial photosynthetic systems?

Incorporating recombinant Lactuca sativa CP47 into artificial photosynthetic systems requires a systematic approach:

  • Substrate selection:

    • Conductive surfaces (gold, graphene, indium tin oxide)

    • Functionalized with appropriate chemical linkers

    • Surface characterization before protein attachment

  • Protein orientation:

    • Site-specific attachment strategies

    • Engineered cysteine residues for directed coupling

    • Spacers to prevent steric hindrance

  • Supporting components:

    • Incorporation of lipids or membrane mimetics

    • Addition of other Photosystem II proteins

    • Integration with synthetic light-harvesting components

  • Performance evaluation:

    • Light-induced electron transfer measurements

    • Photocurrent generation assessment

    • Stability monitoring under continuous illumination

  • Optimization strategies:

    • Protective coatings to extend system lifetime

    • Redox mediators to enhance electron transfer

    • Temperature and pH optimization

Progress in this area requires interdisciplinary collaboration between protein biochemists, surface chemists, and materials scientists. Successful integration depends on maintaining the protein's native conformation while establishing electrical connectivity with the artificial system components.

What emerging techniques could enhance our understanding of CP47 structure-function relationships in Lactuca sativa?

Several cutting-edge techniques show promise for deepening our understanding of CP47:

  • Single-molecule spectroscopy:

    • Reveals heterogeneity in protein behavior obscured in bulk measurements

    • Can track conformational changes during photosynthetic function

    • Allows observation of rare or transient states

  • Advanced cryo-EM approaches:

    • Time-resolved cryo-EM to capture different functional states

    • Correlative light and electron microscopy for structure-function studies

    • In situ structural determination within native membrane environments

  • Quantum biology methods:

    • Quantum coherence measurements in energy transfer processes

    • Theoretical modeling of quantum effects in chlorophyll arrangements

    • Investigation of quantum entanglement in photosynthetic light harvesting

  • Artificial intelligence applications:

    • Machine learning for structure prediction from sequence

    • Pattern recognition in spectroscopic data

    • Simulation of protein dynamics under different conditions

These emerging approaches may reveal new insights into how CP47's structure facilitates its function in photosynthetic energy capture and transfer, potentially leading to improved artificial photosynthetic systems.

How might comparative studies between Lactuca sativa and other plant species inform CP47 engineering?

Comparative studies between CP47 from Lactuca sativa and other plant species can provide valuable insights for protein engineering:

Plant SpeciesPhotosynthetic EfficiencyEnvironmental AdaptationPotential Engineering Insights
Spinach (Spinacia oleracea)ModerateTemperate climate76% amino acid homology with cyanobacterial CP47 ; benchmark for comparison
Rice (Oryza sativa)HighVariable conditionsAdaptation to high light intensity
Ice plant (Mesembryanthemum)HighDrought toleranceStability under water stress
Shade-adapted speciesOptimized for low lightForest understoryEnhanced light capture efficiency
C4 plants (e.g., maize)HighHot, dry conditionsModified energy distribution

By identifying specific amino acid differences that correlate with functional adaptations across species, researchers can design targeted modifications to Lactuca sativa CP47 that enhance desired properties such as stability, light-harvesting efficiency, or tolerance to specific environmental stressors.

What are the implications of CP47 research for developing drought-resistant crops?

Research on CP47 has significant implications for developing drought-resistant crops:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.