Recombinant Lactuca sativa Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

The D1 protein is integral to Photosystem II (PSII), facilitating electron transfer via:

  1. Q<sub>B</sub> Binding: Acts as the secondary electron acceptor, transferring electrons to plastoquinone .

  2. Herbicide Interaction: The Q<sub>B</sub> pocket is a target for herbicides like diuron and terbutryn, which block electron transport .

  3. Light-Regulated Expression: The psbA 5′-UTR enables light-inducible translation, enhancing recombinant protein yields under controlled conditions .

Herbicide Binding Studies

  • Mechanistic Insights: The recombinant protein enables in vitro assays to study herbicide affinity and resistance mutations. For example:

    • Diuron and terbutryn exhibit high binding affinity (I<sub>50</sub> values ≤1 µM) .

    • Mutations in D1 (e.g., Ser<sub>264</sub>→Gly) reduce herbicide efficacy .

Photosystem Assembly Analysis

  • Structural Dynamics: Cryo-EM and NMR studies reveal that Psb28 (an assembly factor) binds to the D1 D-E loop, stabilizing immature PSII complexes .

  • Q<sub>B</sub> Site Maturation: The recombinant protein aids in characterizing Q<sub>B</sub> pocket assembly, which requires coordination with non-heme iron and CP47 .

Biotechnological Optimization

  • Yield Enhancement: Deleting endogenous psbA in chloroplasts increases recombinant protein expression by reducing competition for transcription/translation machinery .

  • Light-Inducible Systems: The psbA promoter enables controlled expression, minimizing toxicity in host organisms .

Future Directions

  • Herbicide Design: Structural data from recombinant D1 can guide the development of herbicides with improved Q<sub>B</sub> binding specificity .

  • Photosynthesis Engineering: Optimizing light-regulated expression systems may enhance recombinant protein yields for industrial applications .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Lactuca sativa (Garden lettuce)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient for subsequent ATP formation. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several downstream electron acceptors.
Database Links

KEGG: lsv:3772788

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the electron tunneling process from QA to QB function at the molecular level?

The electron tunneling from QA to QB occurs through a superexchange mechanism mediated by a nonheme iron complex and involves several key molecular components:

  • Superexchange Pathways: Electron transfer from QA to QB involves superexchange pathways through a nonheme Fe complex. This process is enhanced by hybridized σ/σ* orbitals of histidines (specifically D2-His214 and D1-His215) .

  • Wave Function Penetration: The electron tunneling is facilitated by the penetration of the wave function into hydrogen bonds with both QA and QB .

  • Histidine Coupling: Despite a large energy gap to the intermediate states, the contributions of histidine σ/σ* orbitals to the superexchange coupling are larger than those of π/π* orbitals .

  • Iron's Role: Interestingly, Fe2+ is not essential for the QA → QB electron tunneling because hybridized histidine molecular orbitals can couple with both QA and QB simultaneously even without Fe d orbitals .

The calculated electronic coupling for the QA–QB distance of approximately 13 Å falls within a reasonable range based on previously reported coupling–distance relationships for metalloproteins .

What structural elements enhance electron tunneling efficiency between QA and QB?

Several structural elements significantly enhance the efficiency of electron tunneling between QA and QB:

  • Hydrogen Bond Network: The electron tunneling rate is substantially enhanced by hydrogen bonds in the QA···D2-His214···Fe2+···D1-His215···QB network. This effect aligns with empirical analyses of electron tunneling rates in heme proteins, which are also enhanced by hydrogen bonds .

  • Histidine Residues: D2-His214 and D1-His215 play a critical role by forming hydrogen bonds with QA and QB, respectively. These histidines provide orbital pathways that facilitate electron tunneling .

  • Superexchange Coupling: The hybridized σ/σ* orbitals of histidines contribute significantly to superexchange coupling, which enhances the electron tunneling rate .

  • Distance and Orientation: The QB protein maintains optimal positioning of the quinone molecule, ensuring appropriate distance and orientation relative to QA for efficient electron tunneling .

This structural arrangement allows for efficient long-range electron transfer despite the considerable distance between QA and QB, making it a remarkable example of biological electron transport.

How do conformational changes in Q(B) protein affect electron transfer rates?

Conformational changes in the Q(B) protein significantly impact electron transfer rates through several mechanisms:

  • QB Flexibility: The B-factor of QB (approximately 69) is larger than that of QA (approximately 24), indicating that QB is more disordered or flexible. This flexibility affects the stability of hydrogen bonds critical for electron transfer .

  • D1-His215···QB Hydrogen Bond: Inhibition of the D1-His215···QB hydrogen bond due to disorder may be one of the reasons why experimentally observed QA → QB electron tunneling rates are slower than theoretically predicted values .

  • Conformational Gating: The question remains whether conformational gating affects the QA → QB electron tunneling in photosystem II. This refers to the process where protein conformational changes must occur before electron transfer can proceed .

  • QB Site Occupancy: The oxidation kinetics of QA- can vary depending on whether the QB binding site is occupied by plastoquinone, plastoquinol, or neither. When the site is empty, the time constant for QA- oxidation increases to 2-3 ms compared to 0.2-0.4 ms when QB is present .

  • Site Blocking: If the QB site is temporarily blocked by the presence of QBH2 or other low-affinity inhibitors, the time constant for QA- oxidation can increase to approximately 0.1 seconds .

These factors highlight the importance of protein dynamics and conformational states in regulating electron transfer rates in photosystem II.

What computational approaches can be used to study electron tunneling involving Q(B) protein?

Researchers can employ several computational approaches to study electron tunneling involving the Q(B) protein:

  • Quantum Mechanics/Molecular Mechanics (QM/MM): This hybrid approach allows for quantum mechanical treatment of the active site (including QA, QB, Fe complex, and key histidine residues) while treating the rest of the protein with molecular mechanics. This method has been successfully applied to analyze superexchange pathways in photosystem II .

  • Polarizable Continuum Model (PCM): Incorporating PCM with a dielectric constant appropriate for the protein environment (typically around 80 for water-surrounding regions) reproduces the polarization effects on electron transfer .

  • Marcus-Levich-Jortner Theory: This theoretical framework evaluates electron tunneling rates by considering electronic coupling, energy difference, and the Franck-Condon factor .

  • B3LYP Functional with 6-31G Basis Set*: This level of theory provides a reasonable balance between accuracy and computational cost for geometry optimization of the quantum mechanical region .

  • Analysis of Molecular Orbitals: Examining the contributions of different molecular orbitals (MOs) to superexchange coupling helps identify key pathways for electron tunneling .

For optimal results, researchers should combine these computational approaches with experimental data to validate and refine their models of electron transfer in photosystem II.

How can researchers express and purify recombinant Lactuca sativa Q(B) protein for experimental studies?

While specific protocols for Lactuca sativa Q(B) protein are not explicitly detailed in the provided search results, researchers can utilize standard recombinant protein expression and purification approaches with modifications appropriate for membrane proteins:

  • Expression System Selection: Choose an expression system compatible with membrane proteins, such as E. coli strains designed for membrane protein expression or eukaryotic systems for proteins requiring post-translational modifications.

  • Gene Optimization: Optimize the Q(B) protein gene sequence (as provided in search result ) for the chosen expression system, considering codon usage and potential toxic effects.

  • Vector Design: Incorporate appropriate tags (His-tag is commonly used) to facilitate purification while ensuring they don't interfere with protein folding or function.

  • Expression Conditions: Optimize temperature, induction timing, and duration to maximize protein yield while maintaining proper folding.

  • Membrane Solubilization: Use appropriate detergents or lipid nanodiscs to solubilize the membrane protein while preserving its native structure.

  • Purification Strategy: Employ affinity chromatography followed by size exclusion chromatography to obtain pure protein.

  • Storage Conditions: Store the purified protein in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage, avoiding repeated freeze-thaw cycles .

  • Functional Validation: Verify the activity of the purified protein through electron transfer assays or binding studies with quinone molecules.

This methodological approach provides a framework for obtaining functional recombinant Lactuca sativa Q(B) protein for experimental studies.

How can Q(B) protein research contribute to understanding photosynthetic efficiency in crop plants?

Research on Q(B) protein can significantly contribute to understanding and potentially improving photosynthetic efficiency in crop plants through several avenues:

  • Correlating Photosynthetic Efficiency and Shelf-Life: Studies in lettuce have demonstrated a relationship between photosynthetic genes (including those in photosystems I and II) and shelf-life traits. 'Okeechobee' lettuce (long shelf-life) shows downregulation of genes involved in photosystems I and II compared to short shelf-life varieties .

  • Identifying Rate-Limiting Steps: Understanding the electron transfer from QA to QB provides insights into potential rate-limiting steps in photosynthesis. This knowledge could guide genetic engineering efforts to optimize these processes .

  • Stress Response Mechanisms: Research shows that photosynthesis-related genes are differentially regulated during stress responses. In lettuce, negative regulation of ethylene-activated signaling pathways appears to be related to extended shelf-life, suggesting connections between photosynthetic processes and stress tolerance .

  • Circadian Rhythm Integration: Light harvesting in photosystems I and II is linked to circadian rhythm in lettuce. Genes like PRR5, KIRA, and LUX, which regulate senescence, show differential expression patterns between long and short shelf-life lettuce varieties .

  • Protein Structure-Function Relationships: Detailed understanding of how the Q(B) protein structure facilitates electron transfer can inform targeted modifications to improve photosynthetic efficiency or stress tolerance in crop plants .

By advancing our knowledge of Q(B) protein function in model systems like lettuce, researchers can develop strategies to enhance photosynthetic efficiency, stress tolerance, and post-harvest quality in various crop species.

How does the role of Q(B) protein in lettuce compare to its function in other photosynthetic organisms?

The Q(B) protein's role in lettuce can be compared to its function in other photosynthetic organisms, revealing both conserved mechanisms and species-specific adaptations:

  • Fundamental Mechanism Conservation: The basic mechanism of electron transfer from QA to QB appears to be conserved across oxygenic photosynthetic organisms, including cyanobacteria, algae, and higher plants like lettuce .

  • Comparison with Purple Bacteria: In purple bacteria like Rhodopseudomonas viridis, electron transfer from bacteriopheophytin to ubiquinone involves specific amino acid residues as bridges. The transfer integral for the L-branch is significantly larger than that for the M-branch due to differences in these amino acid bridges. Similarly, the transfer from menaquinone to ubiquinone uses histidine residues (His M217 and His L190) as bridges .

  • Adaptations in QB Binding: Different photosynthetic organisms show variations in the QB binding site that affect quinone binding affinity and electron transfer rates. These adaptations likely reflect evolutionary responses to different environmental conditions .

  • Species-Specific Regulation: In lettuce, photosystem genes show specific expression patterns related to development and stress responses. Genes involved in light harvesting in photosystems I and II are downregulated in long shelf-life varieties compared to short shelf-life varieties, suggesting species-specific regulatory mechanisms .

  • Quinone Exchange Mechanisms: Different photosynthetic organisms have evolved various channels and mechanisms for plastoquinone/plastoquinol exchange, which directly impacts the efficiency of the QB protein's function .

These comparisons highlight both the fundamental conservation of photosynthetic electron transfer mechanisms and the species-specific adaptations that have evolved to optimize photosynthesis in different environmental contexts.

What factors may interfere with electron transfer studies involving recombinant Q(B) protein?

Several factors can potentially interfere with electron transfer studies involving recombinant Q(B) protein:

  • Protein Conformational States: The flexibility and disorder of the QB binding site can affect electron transfer rates. The B-factor of QB (approximately 69) is higher than that of QA (approximately 24), indicating greater disorder that may influence experimental results .

  • Hydrogen Bond Disruption: The inhibition of critical hydrogen bonds, particularly the D1-His215···QB hydrogen bond, can significantly reduce electron transfer rates .

  • QB Site Occupancy: The occupancy state of the QB binding site affects electron transfer kinetics. If the site is empty or occupied by plastoquinol rather than plastoquinone, the electron transfer rates will differ significantly .

  • pH Effects: While the search results indicate that pH effects are "remarkably nonspecific," variations in pH can still influence electron transfer kinetics and should be controlled in experimental settings .

  • Iron Depletion: Although Fe2+ is not essential for QA → QB electron tunneling, its absence may alter the protein structure and the arrangement of histidine residues that facilitate electron transfer .

  • Detergent Effects: For recombinant membrane proteins, the choice of detergent for solubilization can significantly impact protein conformation and activity.

  • Storage Conditions: Improper storage leading to protein degradation or aggregation will affect experimental results. The recombinant protein should be stored in appropriate buffer conditions (Tris-based buffer with 50% glycerol) at -20°C or -80°C for extended storage, avoiding repeated freeze-thaw cycles .

Understanding and controlling these factors are essential for obtaining reliable and reproducible results in studies involving recombinant Q(B) protein.

How can researchers validate the functional integrity of purified recombinant Q(B) protein?

To validate the functional integrity of purified recombinant Q(B) protein, researchers can employ several complementary approaches:

  • Electron Transfer Assays: Measure the electron transfer rates from artificial electron donors to the recombinant Q(B) protein using spectroscopic techniques. Compare these rates with those observed in native photosystem II complexes .

  • Quinone Binding Assays: Assess the protein's ability to bind plastoquinone using fluorescence quenching or isothermal titration calorimetry to determine binding affinities and stoichiometry.

  • Hydrogen Bonding Assessment: Evaluate the formation of critical hydrogen bonds, particularly those involving histidine residues like D1-His215, using infrared spectroscopy or hydrogen-deuterium exchange mass spectrometry .

  • Structural Integrity Analysis: Use circular dichroism spectroscopy to verify the secondary structure composition of the recombinant protein compared to the native protein.

  • Mass Spectrometry Verification: Confirm the protein's identity and integrity using mass spectrometry to verify the complete amino acid sequence and identify any post-translational modifications or truncations .

  • Reconstitution Studies: Incorporate the recombinant protein into liposomes or nanodiscs and assess its ability to participate in electron transfer reactions within this reconstituted system.

  • Inhibitor Sensitivity: Test the protein's response to known inhibitors of QB function, such as DCMU (3-(3,4-dichlorophenyl)-1,1-dimethylurea), which should block electron transfer if the binding site is properly formed.

These validation approaches provide comprehensive assessment of both structural integrity and functional capacity of the purified recombinant Q(B) protein, ensuring its suitability for further research applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.