Recombinant Lagenorhynchus albirostris NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Functional Role

MT-ND4L is a hydrophobic subunit of NADH dehydrogenase (Complex I), responsible for transferring electrons from NADH to ubiquinone in the mitochondrial inner membrane . In Lagenorhynchus albirostris, it is encoded by the mitochondrial genome and shares structural similarities with human MT-ND4L, including overlapping gene sequences with MT-ND4 .

Key Properties of Recombinant MT-ND4L

PropertyDetailsSource
Protein LengthPartial (exact length varies by construct)
Molecular Weight~11 kDa (human homolog); species-specific variations may exist
Purity>85% (SDS-PAGE)
Source OrganismLagenorhynchus albirostris (white-beaked dolphin)
Expression SystemYeast (common for recombinant production)

Mitochondrial Energy Metabolism Studies

MT-ND4L is integral to Complex I, which pumps protons across the mitochondrial membrane to drive ATP synthesis . Recombinant MT-ND4L from Lagenorhynchus albirostris is used to study:

  • Electron transfer mechanisms in cetaceans, which may adapt to hypoxic environments .

  • Species-specific structural variations influencing Complex I activity .

Disease Modeling

Mutations in MT-ND4L are linked to Leber Hereditary Optic Neuropathy (LHON) and metabolic disorders . For example:

  • A T→C mutation at position 10,663 in human MT-ND4L replaces valine with alanine (Val65Ala), impairing Complex I function and ATP production .

  • Studies on cetacean models may provide insights into evolutionary adaptations to mitochondrial dysfunction .

Associated Disorders

DisorderMechanismSource
LHONImpaired electron transport → reduced ATP → retinal ganglion cell death
Metabolic DisordersAltered NADH dehydrogenase activity → obesity, diabetes, hypertension

Diagnostic Tools

Recombinant MT-ND4L is used in ELISA kits to detect protein-specific antibodies or quantify expression levels in research samples .

Comparative Analysis with Human MT-ND4L

FeatureHuman MT-ND4LLagenorhynchus albirostris MT-ND4L
Gene LocationMitochondrial DNA (10,469–10,765 bp)Mitochondrial genome (species-specific)
Overlapping SequenceOverlaps with MT-ND4 in +3 reading frameSimilar overlap pattern in cetaceans
Disease LinkageLHON, metabolic disordersLimited data; research ongoing

** Suppliers and Availability**

Recombinant MT-ND4L from Lagenorhynchus albirostris is commercially available from specialized biotechnology vendors:

SupplierProduct CodeQuantityPrice (EUR)Country
CUSABIO TECHNOLOGY LLCCSB-YP015080HU150 µg1,438.00China
Colorectal ResearchCSB-CF765120LC50 µg1,438.00N/A

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please include it in your order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs unless otherwise requested. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Lagenorhynchus albirostris (White-beaked dolphin) (Delphinus albirostris)
Target Names
Target Protein Sequence
MSLVHINVLIAFTVSLTGLLMYRSHLMSALLCLEGMVLSLFILAALTILNTHFTLANMMP IILLVFAACEAAIGLALLVMVSNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its functional significance in mitochondria?

MT-ND4L is a gene encoded by the mitochondrial genome that produces the NADH-ubiquinone oxidoreductase chain 4L protein. This protein functions as a subunit of NADH dehydrogenase (ubiquinone), also known as Complex I, which is located in the mitochondrial inner membrane and represents the largest of the five complexes in the electron transport chain . The protein is highly hydrophobic and forms part of the core transmembrane region of Complex I. Functionally, MT-ND4L contributes to the minimal assembly of core proteins required for activity of the respiratory chain Complex I, playing an essential role in cellular energy production through oxidative phosphorylation .

To study basic MT-ND4L function, researchers typically employ spectrophotometric assays to measure NADH oxidation rates in isolated mitochondria or reconstituted systems. Blue native polyacrylamide gel electrophoresis (BN-PAGE) followed by in-gel activity assays can also provide valuable insights into Complex I assembly and function when evaluating MT-ND4L's role.

What is the molecular structure and organization of the MT-ND4L gene?

The MT-ND4L gene is located in human mitochondrial DNA spanning from base pair 10,469 to 10,765 . It produces a relatively small protein of approximately 11 kDa, composed of 98 amino acids. A particularly notable feature of MT-ND4L is its unusual 7-nucleotide gene overlap with the MT-ND4 gene. Specifically, the last three codons of MT-ND4L (5'-CAA TGC TAA-3' coding for Gln, Cys, and Stop) overlap with the first three codons of MT-ND4 (5'-ATG CTA AAA-3' coding for Met-Leu-Lys) . This overlapping gene structure creates a complex reading frame relationship where, relative to the MT-ND4L reading frame (+1), the MT-ND4 gene begins in the +3 reading frame.

For researchers studying this gene structure, techniques such as transcript analysis through RT-PCR, RNA-Seq, and ribosome profiling can elucidate how this unusual overlap affects gene expression and translation dynamics.

How can researchers effectively isolate and purify recombinant MT-ND4L for experimental use?

Isolating functional MT-ND4L presents significant challenges due to its hydrophobic nature and mitochondrial localization. For researchers working with recombinant Lagenorhynchus albirostris MT-ND4L, the following methodological approach is recommended:

  • Expression system selection: Prokaryotic systems like E. coli with specialized strains designed for membrane protein expression often provide better yields than mammalian cell systems.

  • Fusion tag optimization: Adding solubility tags (MBP, SUMO, etc.) to recombinant MT-ND4L significantly improves expression and solubility. The commercial recombinant protein uses tag types determined during the production process .

  • Extraction protocol: Use mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin for membrane protein solubilization, maintaining a 50% glycerol concentration in Tris-based buffers as seen in commercial preparations .

  • Purification strategy: Employ affinity chromatography based on the fusion tag, followed by size exclusion chromatography. Store the purified protein at -20°C or -80°C to prevent freezing-thawing cycles, and prepare working aliquots at 4°C for short-term use .

For quality control, circular dichroism spectroscopy can verify proper folding, while functional assays measuring NADH oxidation activity confirm biological activity of the purified protein.

How do MT-ND4L variants contribute to neurodegenerative pathologies like Alzheimer's disease?

Research has revealed significant associations between MT-ND4L variants and neurodegenerative conditions, particularly Alzheimer's disease (AD). A whole exome sequencing study involving 10,831 participants from the Alzheimer's Disease Sequencing Project identified a study-wide significant association between AD and a rare MT-ND4L variant (rs28709356 C>T; minor allele frequency = 0.002; P = 7.3 × 10^-5) . Gene-based testing further confirmed the significance of MT-ND4L in AD pathogenesis (P = 6.71 × 10^-5).

The mechanisms linking MT-ND4L variants to AD likely involve:

  • Impaired oxidative phosphorylation: Mutations may reduce Complex I efficiency, leading to energy deficits in neurons.

  • Enhanced ROS production: Complex I is a major source of reactive oxygen species in mitochondria and contributes significantly to cellular oxidative stress . MT-ND4L mutations potentially increase superoxide production through altered electron transfer from fully reduced flavin to O₂.

  • Mitochondrial dysfunction: MT-ND4L variants may disrupt the electron transport chain assembly and function.

Researchers investigating these connections should employ:

  • Patient-derived fibroblasts or iPSC-neurons carrying the variants

  • Seahorse analysis to measure oxygen consumption rates

  • MitoSOX assays to quantify mitochondrial superoxide production

  • Mitochondrial membrane potential measurements using JC-1 or TMRM

  • Complex I activity assays in isolated mitochondria

  • Proteomics to assess Complex I assembly in carriers vs. controls

What is the role of MT-ND4L in metabolic conditions, and how can researchers effectively model these interactions?

MT-ND4L has been implicated in several metabolic conditions, particularly obesity. Research indicates that certain variants exhibit protective effects, while others increase susceptibility to metabolic disorders:

  • The missense mutation MT:10609T>C in MT-ND4L was found to be negatively correlated with obesity risk, suggesting a protective effect .

  • Variants of human MT-ND4L are generally associated with increased BMI in adults .

This paradoxical relationship indicates complex interplays between specific mutations and metabolic outcomes.

To effectively model these interactions, researchers should consider:

Experimental ApproachApplicationAdvantagesLimitations
Cell-based modelsHepG2 cells or adipocytes with MT-ND4L variantsEasy to manipulateLimited physiological context
CRISPR-mediated mitochondrial DNA editingIntroduction of specific variantsPrecise genetic modificationTechnical challenges in mtDNA editing
Transmitochondrial cybrid modelsTransfer of mitochondria with variants to ρ⁰ cellsPreserves mutation contextCell type limitations
Animal models with humanized mitochondriaIn vivo physiological assessmentSystemic effects observableComplexity and ethical considerations

Functional readouts should include:

  • Lipid accumulation assays

  • Insulin signaling measurements

  • Metabolic flux analysis

  • Mitochondrial respiration assessments

  • Lipidomic and metabolomic profiling

How does MT-ND4L contribute to superoxide production in Complex I, and what methods best characterize this process?

Complex I is a major source of reactive oxygen species in mitochondria and contributes significantly to cellular oxidative stress . Studies of bovine heart mitochondria have elucidated that superoxide formation occurs through the transfer of one electron from fully reduced flavin to O₂ . The resulting flavin radical is unstable, leading to electron redistribution to iron-sulfur centers.

The rate of superoxide production is determined by:

  • A bimolecular reaction between O₂ and reduced flavin in an empty active site

  • A preequilibrium set by the dissociation constants of NADH and NAD⁺

  • The reduction potentials of flavin and NAD⁺

MT-ND4L, as a core subunit of Complex I, influences this process through its contributions to complex assembly and electron transport.

For researchers investigating this phenomenon, these methodological approaches are recommended:

  • Electron paramagnetic resonance spectroscopy to detect superoxide radicals

  • Redox titrations to assess the reduction states of Complex I components

  • Amplex Red assays to measure H₂O₂ production

  • Manipulation of NADH/NAD⁺ ratios to observe effects on superoxide generation

  • Site-directed mutagenesis of key MT-ND4L residues to identify critical regions for superoxide production

Analysis should involve calculations of kinetic parameters (Km, Vmax) for superoxide production under varying substrate concentrations and NADH/NAD⁺ ratios to establish mechanistic models.

What experimental approaches can determine how the overlapping gene structure of MT-ND4L with MT-ND4 affects gene expression and protein function?

The unusual 7-nucleotide gene overlap between MT-ND4L and MT-ND4 presents a fascinating research question regarding coordinate expression and translation. To investigate this phenomenon, researchers should consider the following experimental approaches:

  • RNA structural analysis:

    • RNA footprinting techniques to examine secondary structures

    • SHAPE (Selective 2′-hydroxyl acylation analyzed by primer extension) analysis to probe RNA accessibility

    • CLASH (crosslinking, ligation, and sequencing of hybrids) to identify RNA-RNA interactions

  • Translation dynamics:

    • Ribosome profiling to quantify translational efficiency at the overlap region

    • In vitro translation systems using purified mitochondrial ribosomes

    • Site-directed mutagenesis to modify the overlap region and assess effects on expression

  • Protein interaction studies:

    • Crosslinking followed by mass spectrometry to detect interactions between MT-ND4L and MT-ND4

    • Proximity labeling approaches (BioID, APEX) in mitochondria

    • Fluorescence resonance energy transfer (FRET) with tagged proteins

  • Computational modeling:

    • Molecular dynamics simulations of the co-translational folding process

    • Prediction of RNA secondary structures at the overlap region

    • Evolutionary conservation analysis across species

These approaches can reveal how this unusual genomic arrangement contributes to coordinated expression, co-translational assembly, or functional interdependence between these two Complex I subunits.

What techniques best evaluate the structural integration of recombinant MT-ND4L into Complex I for functional studies?

Assessing proper integration of recombinant MT-ND4L into the multisubunit Complex I presents significant challenges. Researchers should employ multiple complementary approaches:

  • Structural validation techniques:

    • Cryo-electron microscopy of reconstituted complexes

    • Cross-linking mass spectrometry (XL-MS) to identify interaction partners

    • Hydrogen-deuterium exchange mass spectrometry to assess structural dynamics

    • Site-directed spin labeling coupled with electron paramagnetic resonance

  • Functional assessment methods:

    • NADH:ubiquinone oxidoreductase activity assays

    • Membrane potential measurements in reconstituted proteoliposomes

    • Proton pumping assays with pH-sensitive fluorescent probes

    • Superoxide production measurements using luminescent or fluorescent indicators

  • Integration verification:

    • Blue Native PAGE to assess complex formation

    • Immunoprecipitation with antibodies against other Complex I subunits

    • Thermal shift assays to evaluate stability of assembled complexes

    • Protease protection assays to determine proper membrane insertion

  • Molecular replacement strategies:

    • Depletion of native MT-ND4L using RNA interference in cybrid cells

    • Complementation with recombinant protein to restore function

    • Isotope labeling of recombinant protein to track incorporation using mass spectrometry

These approaches collectively provide a comprehensive assessment of whether recombinant MT-ND4L properly integrates into Complex I and contributes to its functional activities.

How can recombinant MT-ND4L be effectively utilized in drug discovery for mitochondrial disorders?

Recombinant Lagenorhynchus albirostris MT-ND4L provides valuable opportunities for drug discovery targeting mitochondrial disorders. The following research pipeline can be implemented:

  • High-throughput screening platform development:

    • Immobilize recombinant MT-ND4L protein (50 μg quantity is typical for commercial preparations) on biosensor chips

    • Develop fluorescence-based binding assays

    • Create reconstituted membrane systems containing MT-ND4L

  • Compound screening strategy:

    • Test compounds that may stabilize mutant MT-ND4L proteins

    • Screen for molecules that enhance Complex I assembly

    • Identify compounds that reduce superoxide production without inhibiting electron transport

  • Validation in cellular models:

    • Assess compounds in cybrid cells harboring pathogenic MT-ND4L mutations

    • Measure endpoints including NADH:ubiquinone oxidoreductase activity, ROS production, ATP generation, and cell viability

    • Evaluate effects on mitochondrial membrane potential and morphology

  • Translation to disease models:

    • Test lead compounds in animal models with relevant MT-ND4L mutations

    • Assess cognitive outcomes for neurodegenerative applications

    • Measure metabolic parameters for obesity-related applications

This systematic approach enables the identification of compounds that may specifically modulate MT-ND4L function or compensate for pathogenic variants associated with diseases like LHON or AD.

What bioinformatic approaches can identify functional consequences of MT-ND4L variants across populations?

To comprehensively analyze MT-ND4L variants across populations, researchers should implement a multi-faceted bioinformatic pipeline:

  • Variant identification and annotation:

    • Extract MT-ND4L variants from whole exome sequencing data using specialized mitochondrial variant calling pipelines that account for heteroplasmy

    • Compare detection rates between different sequencing technologies (e.g., Nextera Rapid Capture Exome kit showed 87% detection versus 70% with TruSeq Exome Enrichment kit)

    • Account for technical challenges in mitochondrial sequencing, including alignment errors in complex regions

  • Population genetics analysis:

    • Calculate variant frequencies across different populations

    • Identify population-specific variants and haplogroups

    • Perform selection pressure analysis on MT-ND4L

  • Functional prediction:

    • Apply protein structure modeling to predict effects of amino acid substitutions

    • Utilize conservation analysis across species to identify critical residues

    • Perform molecular dynamics simulations to assess structural impacts

  • Phenotype association:

    • Implement SCORE tests and SKAT-O methods for robust association testing

    • Perform meta-analysis across multiple cohorts

    • Develop mitochondrial polygenic risk scores incorporating MT-ND4L variants

  • Pathway integration:

    • Analyze interactions between MT-ND4L variants and nuclear genes (like TAMM41)

    • Map variants to biochemical pathways affected in mitochondrial disorders

    • Model epistatic interactions between mitochondrial and nuclear variants

This comprehensive approach has successfully identified associations between MT-ND4L variants and conditions like Alzheimer's disease (rs28709356) and obesity protection (MT:10609T>C) .

What are the key challenges in detecting MT-ND4L variants from whole exome sequencing data?

Researchers face several technical challenges when identifying MT-ND4L variants from whole exome sequencing data. A comparative analysis between different sequencing approaches revealed the following issues and solutions:

ChallengeExplanationRecommended Solution
Non-uniform coverageCoverage of MT-ND4L varies significantly between exome capture kits (Nextera Rapid Capture: 87% detection; TruSeq Exome Enrichment: 70%) Select appropriate capture kits with verified mitochondrial coverage; implement targeted amplification for low-coverage regions
Alignment errorsVariants at positions like MT:302, MT:309, and MT:310 show inconsistencies between Sanger and NGS results Use specialized mitochondrial genome aligners; incorporate circular genome handling in bioinformatic pipelines
Repeated poly-C regionsCommon sequencing errors in homopolymer stretchesImplement post-processing algorithms specific for homopolymer regions; verify with orthogonal methods
Low read coverageParticularly problematic at the start and end of the mitochondrial genome Implement minimum coverage thresholds; use sliding window approaches for coverage verification
False-positive variantsCan result from alignment errors and technical artifactsImplement strict filtering criteria; validate with orthogonal methods like Sanger sequencing
Heteroplasmy detectionDifficulty in distinguishing low-level heteroplasmy from sequencing errorsUse statistical models specifically designed for heteroplasmy detection; implement variant allele frequency thresholds

Despite these challenges, whole-exome sequencing remains a cost- and time-effective alternative for mitochondrial studies compared to whole-genome sequencing, particularly for association studies . To maximize accuracy, researchers should implement specialized mitochondrial variant calling pipelines that address these specific technical issues.

How can researchers effectively study the functional impacts of MT-ND4L variants in cellular models?

To comprehensively assess functional impacts of MT-ND4L variants in cellular models, researchers should implement an integrated experimental approach:

  • Cellular model development:

    • Generate transmitochondrial cybrid models by fusing ρ⁰ cells with patient-derived platelets harboring MT-ND4L variants

    • Develop CRISPR-based approaches for targeted modification of MT-ND4L in mitochondrial DNA

    • Use bacterial artificial chromosome (BAC) systems for allotopic expression of MT-ND4L variants

  • Functional assessment battery:

    • Measure Complex I activity using spectrophotometric assays

    • Quantify superoxide production, which is formed by electron transfer from fully reduced flavin to O₂

    • Assess cellular bioenergetics using Seahorse XF analyzers

    • Evaluate mitochondrial membrane potential with potentiometric dyes

    • Measure ATP production under different substrate conditions

  • Structural analysis:

    • Assess Complex I assembly using blue native gel electrophoresis

    • Implement proteomics approaches to quantify subunit incorporation

    • Use super-resolution microscopy to evaluate mitochondrial ultrastructure

  • Disease-specific phenotyping:

    • For AD-associated variants like rs28709356 , measure amyloid processing and tau phosphorylation

    • For obesity-related variants like MT:10609T>C , assess lipid metabolism and adipocyte differentiation

    • For LHON-associated variants, evaluate retinal ganglion cell survival and axonal transport

  • Drug screening:

    • Test compounds that may rescue phenotypes in variant-expressing cells

    • Implement high-content screening approaches for phenotypic rescue

    • Validate hits using dose-response analyses and specificity testing

This systematic approach provides a comprehensive framework for functional characterization of MT-ND4L variants, enabling both mechanistic insights and therapeutic development.

What emerging technologies will advance the study of MT-ND4L structure-function relationships?

Several cutting-edge technologies are poised to revolutionize our understanding of MT-ND4L structure-function relationships:

  • Advanced structural biology approaches:

    • Cryo-electron tomography of intact mitochondria to visualize Complex I in native membrane environments

    • Integrative structural biology combining cryo-EM, crosslinking-mass spectrometry, and molecular dynamics

    • Time-resolved structural methods to capture dynamic conformational changes during electron transport

  • Precision genome editing technologies:

    • Mitochondrial base editors adapted for MT-ND4L modifications

    • CRISPR-free approaches for introducing precise mutations into mtDNA

    • Heteroplasmy shifting technologies to model varying levels of mutant load

  • Single-molecule techniques:

    • Single-molecule FRET to monitor conformational dynamics

    • Nanopore-based approaches for studying individual Complex I molecules

    • Optical tweezers combined with electrical recordings to correlate mechanical changes with proton pumping

  • Advanced computational approaches:

    • Quantum mechanical/molecular mechanical (QM/MM) simulations of electron transport

    • Machine learning algorithms to predict functional impacts of variants

    • Network biology approaches integrating mitochondrial and nuclear genetic interactions

  • Innovative imaging technologies:

    • Super-resolution microscopy with mitochondrial-specific probes

    • Label-free imaging using stimulated Raman scattering

    • Correlative light and electron microscopy for structure-function studies

These emerging technologies will provide unprecedented insights into how MT-ND4L contributes to Complex I assembly, stability, electron transport, and proton pumping, potentially revealing new therapeutic targets for disorders associated with MT-ND4L dysfunction.

How might comparative studies of MT-ND4L across species inform human disease research?

Comparative studies of MT-ND4L across species offer valuable insights for human disease research. The evolutionary conservation of this protein provides a framework for identifying functionally critical regions and interpreting human variants. Researchers should consider these methodological approaches:

  • Evolutionary analysis framework:

    • Sequence alignment of MT-ND4L from diverse species including Lagenorhynchus albirostris (white-beaked dolphin)

    • Calculation of conservation scores to identify functional hotspots

    • Reconstruction of ancestral sequences to infer evolutionary trajectories

    • Identification of sites under positive selection versus purifying selection

  • Structure-function comparative studies:

    • Analysis of natural variants in non-human species that correspond to human disease mutations

    • Evaluation of compensatory mutations that may mitigate pathogenic effects

    • Identification of species-specific adaptations related to metabolic demands

  • Disease model selection based on comparative data:

    • Identification of species with naturally occurring variants mimicking human pathogenic mutations

    • Development of animal models based on evolutionary insights

    • Creation of chimeric proteins incorporating domains from different species

  • Therapeutic development informed by comparative genomics:

    • Targeting of highly conserved regions for drug development

    • Identification of natural compensatory mechanisms from species resistant to specific MT-ND4L defects

    • Exploration of alternative electron transport pathways present in some species

This evolutionary medicine approach provides a powerful framework for understanding MT-ND4L function and identifying potential therapeutic strategies based on natural solutions that have evolved across different species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.