Recombinant Lagostrophus fasciatus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Functional Role in Complex I

As a subunit of Complex I, MT-ND4L contributes to:

  1. Electron transport: Transfers electrons from FMNH₂ to iron-sulfur clusters and ubiquinone .

  2. Proton pumping: Generates a proton gradient across the mitochondrial membrane, driving ATP synthesis .

  3. Complex assembly: Interacts with mitochondrial-encoded and nuclear-encoded subunits to stabilize Complex I’s structure .

Disruption of MT-ND4L function, as observed in human MT-ND4L mutations, is linked to Leber’s Hereditary Optic Neuropathy (LHON) and metabolic disorders .

Research Applications and Challenges

Recombinant MT-ND4L proteins are used to:

  • Study Complex I assembly: Investigate subunit interactions and electron transport mechanisms .

  • Model mitochondrial diseases: Analyze mutations linked to LHON and metabolic disorders .

  • Develop diagnostic tools: Enable functional assays for Complex I activity .

Challenges include:

  • Low solubility: Hydrophobic nature complicates purification and structural studies .

  • Species-specific variability: Sequence divergence may affect cross-species functional studies .

Clinical and Biological Significance

MT-ND4L dysfunction is implicated in:

  • Leber’s Hereditary Optic Neuropathy: A T10663C mutation in human MT-ND4L causes optic nerve degeneration .

  • Metabolic disorders: Variants correlate with obesity, diabetes, and hypertension .

  • Neuroprotection: Overexpression of NDUFA4 (a Complex I subunit) promotes neuronal survival via anti-apoptotic pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Lagostrophus fasciatus (Banded hare-wallaby)
Target Names
Target Protein Sequence
MMSINLNLIMAFSLALAGVLIYRSHLMSTLLCLEGMMLSLFILMALIISHFHMFSTSMAP LILLVFSACEAGVGLALLVKTSSNYGNDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.