Recombinant Lagothrix lagotricha Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Lagothrix lagotricha (Brown woolly monkey) (Humboldt's woolly monkey)
Target Names
Target Protein Sequence
MAHPAQLGLQNATSPIMEELIAFHDHALMIIFLISSLVLYIISLMLTTKLTHTSTMNAQE IEMVWTILPAIILIMIALPSLRILYMTDEFNKPYLTLKAIGHQWYWSYEYSDYVDLAFDY YITPTYFLEPGEFRLLEVDNRTTLPMEADIRMLISSQDVLHSWAVPSLGVKTDAIPGRLN QAMLASMRPGLFYGQCSEICGSNHSFMPIVLEFIYFQDFEVWASYLYIVSL
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a crucial component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This complex drives oxidative phosphorylation by facilitating electron transfer from NADH and succinate to molecular oxygen. The respiratory chain, encompassing three multi-subunit complexes (succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (complex IV, CIV)), generates an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the CuA center (subunit 2) and heme A (subunit 1) to the binuclear center (BNC) in subunit 1. The BNC, comprising heme A3 and CuB, reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MT-CO2 in Lagothrix lagotricha and how does it compare to other primates?

MT-CO2 (mitochondrially encoded cytochrome c oxidase subunit II) is a critical component of the respiratory chain complex IV in Lagothrix lagotricha. This protein contributes to cytochrome-c oxidase activity and is involved in mitochondrial electron transport, specifically in the transfer of electrons from cytochrome c to oxygen . In the mitochondrial inner membrane, MT-CO2 facilitates the reduction of oxygen to water as part of the electron transport chain that drives oxidative phosphorylation .

Comparative studies across primates have revealed that monkeys and apes, including Lagothrix lagotricha, have undergone a nearly two-fold increase in the rate of amino acid replacement in the MT-CO2 gene compared to other primates . While functionally important amino acids remain conserved across primates, there is increased variation in the amino terminal end of the protein in higher primates . The replacement of two carboxyl-bearing residues (glutamate and aspartate) at positions 114 and 115 in higher primates may explain the poor enzyme kinetics observed in cross-reactions between the cytochromes c and cytochrome c oxidases of higher primates and other mammals .

What genomic characteristics define MT-CO2 in Lagothrix lagotricha?

The MT-CO2 gene in primates, including Lagothrix lagotricha, is located on the mitochondrial chromosome. In humans, the MT-CO2 gene spans positions 7586-8269 on the mitochondrial chromosome (NC_012920.1) . While specific genomic data for Lagothrix lagotricha MT-CO2 is limited in the available literature, comparative genomic analyses across primates indicate conservation of key functional domains.

The gene encoding MT-CO2 is protein-coding with no exons reported in the genomic structure . Phylogenetic analyses of the MT-CO2 gene have been used to establish evolutionary relationships among primates, with New World monkeys (including Lagothrix) showing distinctive evolutionary patterns compared to Old World monkeys and hominoids .

How can researchers confirm the identity of recombinant Lagothrix lagotricha MT-CO2?

Verification of recombinant Lagothrix lagotricha MT-CO2 requires multiple approaches:

  • Sequence confirmation through DNA sequencing of the expression construct

  • Western blotting using anti-MT-CO2 antibodies (similar to those used for human MT-CO2)

  • Mass spectrometry analysis to confirm protein mass and sequence

  • Functional assays measuring cytochrome c oxidase activity

Researchers can use commercially available antibodies that target conserved epitopes of MT-CO2, such as those that target the C-terminal region . These antibodies may cross-react with Lagothrix MT-CO2 due to the high conservation of functional domains across primates. Validation assays should include positive controls using native Lagothrix tissue samples when available, with appropriate ethical considerations for samples from this endangered species .

What expression systems are optimal for producing functional recombinant Lagothrix lagotricha MT-CO2?

The choice of expression system for recombinant Lagothrix lagotricha MT-CO2 must consider both yield and functional integrity. Based on approaches used for similar mitochondrial proteins:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, rapid production, cost-effectivePotential improper folding, lack of post-translational modificationsInitial structural studies, antibody production
Insect cellsBetter folding than bacterial systems, some post-translational modificationsModerate yield, more complex than bacterial systemsFunctional studies requiring partial activity
Mammalian cells (e.g., CHO, HEK293)Proper folding and post-translational modificationsLower yield, time-consuming, expensiveFunctional studies requiring native-like activity
Wheat germ extractCell-free system, good for difficult-to-express proteinsModerate yieldProtein interaction studies

When selecting an expression system, researchers should consider that cytochrome c oxidase is a complex multi-subunit enzyme. The MT-CO2 subunit alone may not exhibit full functionality without the context of the complete complex. For studies requiring functional protein, co-expression with other subunits may be necessary.

What purification strategies are most effective for isolating recombinant Lagothrix lagotricha MT-CO2?

Effective purification of recombinant Lagothrix lagotricha MT-CO2 typically involves a multi-step approach:

  • Initial capture using affinity chromatography:

    • His-tag affinity if a histidine tag is incorporated

    • Immunoaffinity using anti-MT-CO2 antibodies

  • Intermediate purification:

    • Ion exchange chromatography based on the predicted isoelectric point

    • Hydrophobic interaction chromatography

  • Polishing steps:

    • Size exclusion chromatography to ensure protein homogeneity

    • Removal of any affinity tags using specific proteases

The membrane-associated nature of MT-CO2 presents challenges during purification. Incorporating appropriate detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin throughout the purification process helps maintain protein stability and solubility. The choice of detergent should balance efficient solubilization with preservation of protein structure and function.

How can researchers assess the structural integrity of purified recombinant Lagothrix lagotricha MT-CO2?

Multiple complementary techniques should be employed to evaluate structural integrity:

  • Circular dichroism (CD) spectroscopy to assess secondary structure elements

  • Thermal shift assays to determine protein stability

  • Limited proteolysis to evaluate folding quality

  • Native PAGE to assess oligomeric state

  • Hydrogen-deuterium exchange mass spectrometry for detailed structural analysis

The purified protein should be compared with predicted structural characteristics based on homology models derived from closely related primate MT-CO2 structures. Given the high conservation of functionally important amino acids among primates , significant structural deviations might indicate compromised integrity during expression or purification.

What are the recommended assays for measuring the enzymatic activity of recombinant Lagothrix lagotricha MT-CO2?

Since MT-CO2 functions as part of the larger cytochrome c oxidase complex, activity assays should ideally be performed in the context of the complete complex or reconstituted systems:

  • Oxygen consumption assay using Clark-type oxygen electrodes

  • Cytochrome c oxidation assay monitoring the decrease in absorbance at 550 nm

  • Electron transfer kinetics using stopped-flow spectroscopy

  • Membrane potential measurements using voltage-sensitive dyes

When developing these assays, researchers should consider the specific environment of the mitochondrial inner membrane, where MT-CO2 naturally functions . The activity of recombinant Lagothrix lagotricha MT-CO2 should be compared with human MT-CO2 to identify any functional differences that might relate to the known amino acid substitutions between primate species .

How do amino acid variations in Lagothrix lagotricha MT-CO2 affect its functional properties compared to human MT-CO2?

Based on comparative studies of primate MT-CO2, key functional differences may arise from:

  • Variations in the amino terminal region, which shows increased diversity among higher primates

  • Substitutions at positions equivalent to 114 and 115 in human MT-CO2, where carboxyl-bearing residues affect enzyme kinetics

  • Other species-specific substitutions that may influence interactions with other subunits or with cytochrome c

Functional analysis should include enzyme kinetics studies comparing:

ParameterMethod of DeterminationExpected Differences
Km for cytochrome cSteady-state kineticsPotential differences due to interface variations
VmaxSteady-state kineticsMay reflect electron transfer efficiency differences
Oxygen binding affinityOxygen electrode studiesExpected to be similar across primates
Proton pumping efficiencyReconstituted liposome studiesMay vary based on structural differences

The analysis should account for the nearly two-fold increase in amino acid replacement rates observed in monkeys and apes compared to other primates , which might affect the catalytic properties of Lagothrix lagotricha MT-CO2.

What considerations are necessary when designing antibodies against Lagothrix lagotricha MT-CO2?

When designing antibodies for Lagothrix lagotricha MT-CO2 detection and purification:

  • Target conserved epitopes when cross-reactivity with other primate MT-CO2 is desired

  • Target unique regions when specificity for Lagothrix lagotricha MT-CO2 is required

  • Consider using recombinant antibody technology to avoid the need for animal immunization

  • Validate antibody specificity against related primate MT-CO2 proteins

For epitope selection, researchers should analyze:

  • Sequence alignments of MT-CO2 across primates to identify conserved and variable regions

  • Structural models to ensure selected epitopes are surface-exposed

  • Potential post-translational modification sites that might interfere with antibody binding

Commercial antibodies such as anti-MT-CO2 recombinant antibodies may cross-react with Lagothrix lagotricha MT-CO2 due to conservation of epitopes . Validation studies should include appropriate controls to confirm specificity.

How has the MT-CO2 gene evolved across primate lineages, and what does this reveal about Lagothrix lagotricha?

Evolutionary analysis of the MT-CO2 gene provides important context for understanding Lagothrix-specific characteristics:

  • Monkeys and apes have experienced a nearly two-fold increase in amino acid replacement rates compared to other primates

  • Despite this accelerated evolution, functionally critical amino acids remain conserved across primate species

  • The amino terminal region of MT-CO2 shows increased variation in higher primates

  • The replacement of glutamate and aspartate residues at positions 114 and 115 affects enzyme function in higher primates

Phylogenetic analysis places New World monkeys like Lagothrix in a distinct evolutionary branch compared to Old World monkeys and hominoids. Studies of MT-CO2 have contributed to primate phylogenetic reconstructions, supporting the sister-group relationship between tarsiers and monkey/ape clades .

What insights can comparative analyses of MT-CO2 provide for understanding mitochondrial diseases in primates?

Comparative analyses of MT-CO2 across primates can yield insights into mitochondrial disease mechanisms:

  • Variations in MT-CO2 are associated with conditions like MELAS syndrome in humans

  • Species-specific adaptations may reveal protective mechanisms against mitochondrial dysfunction

  • Conservation of critical residues indicates functional constraints across evolution

Researchers studying Lagothrix lagotricha MT-CO2 should examine:

  • Known pathogenic variants in human MT-CO2 and their equivalent positions in Lagothrix

  • Species-specific variations that might confer differential susceptibility to mitochondrial stress

  • Potential compensatory mutations that maintain function despite sequence divergence

The biomarker potential of MT-CO2 for conditions like Huntington's disease and stomach cancer in humans suggests comparative studies might reveal species-specific disease associations.

How do the biochemical properties of Lagothrix lagotricha MT-CO2 compare to those of other New World monkeys?

A detailed comparison of biochemical properties across New World monkey species reveals patterns of functional conservation and divergence:

PropertyLagothrix lagotrichaOther New World MonkeysOld World PrimatesFunctional Implication
Isoelectric pointPredicted based on sequenceVariable across speciesMore conservedAffects membrane interactions
Hydrophobicity profileConserved transmembrane regionsConservedConservedCritical for membrane integration
Metal binding sitesHighly conservedHighly conservedHighly conservedEssential for electron transport
Cytochrome c binding interfaceSome variationSpecies-specific variationsDifferent from New World monkeysAffects electron transfer efficiency

The poor enzyme kinetics observed in cross-reactions between cytochromes c and cytochrome c oxidases of higher primates and other mammals suggests species-specific co-evolution of these interacting proteins, which should be considered when studying Lagothrix lagotricha MT-CO2.

What are the major challenges in expressing and purifying functional recombinant Lagothrix lagotricha MT-CO2?

Researchers face several technical challenges when working with recombinant Lagothrix lagotricha MT-CO2:

  • Membrane protein expression issues:

    • Potential toxicity to host cells

    • Proper membrane integration

    • Achieving sufficient yield without compromising quality

  • Purification challenges:

    • Maintaining stability during solubilization

    • Preventing aggregation

    • Preserving native-like conformation

  • Functional assessment difficulties:

    • MT-CO2 functions as part of a multi-subunit complex

    • Reproducing the native lipid environment

    • Measuring activity in isolation versus complex context

To address these challenges, researchers should consider:

  • Employing inducible expression systems with tight regulation

  • Using fusion partners to enhance solubility and facilitate purification

  • Screening multiple detergents for optimal solubilization

  • Reconstituting with other subunits for functional studies

How can researchers overcome the limited availability of reference materials for Lagothrix lagotricha MT-CO2?

The endangered status of Lagothrix lagotricha creates ethical and practical limitations for obtaining reference materials. Researchers can address this through:

  • Non-invasive sampling approaches:

    • Cell lines derived from ethically obtained samples

    • Use of already existing biobank specimens

    • Collaboration with conservation and rescue centers

  • Computational and bioinformatic strategies:

    • Homology modeling based on closely related species

    • Sequence prediction and analysis

    • Molecular dynamics simulations

  • Synthetic biology approaches:

    • Gene synthesis based on predicted sequences

    • Creation of chimeric proteins with known regions from related species

    • Directed evolution to understand functional constraints

When working with limited reference materials, validation becomes critical. Cross-validation with multiple approaches and careful documentation of the provenance of any biological materials is essential for reproducible research.

What quality control measures are essential for ensuring the reliability of research with recombinant Lagothrix lagotricha MT-CO2?

Rigorous quality control is necessary throughout the research process:

  • Genetic material authentication:

    • DNA sequencing to confirm MT-CO2 sequence identity

    • Verification against available reference sequences

    • Documentation of any sequence variations

  • Protein quality assessments:

    • SDS-PAGE for purity evaluation

    • Mass spectrometry for identity confirmation

    • Circular dichroism for structural integrity

    • Activity assays for functional validation

  • Experimental validation:

    • Multiple technical and biological replicates

    • Inclusion of appropriate positive and negative controls

    • Benchmarking against well-characterized related proteins

  • Documentation standards:

    • Detailed methods reporting

    • Raw data preservation

    • Clear annotation of any limitations or assumptions

Researchers should apply methods similar to those used for commercial antibody validation , including affinity binding assays, western blotting, immunohistochemistry, and flow cytometry with appropriate controls.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.