Recombinant Lama guanicoe pacos Cytochrome c oxidase subunit 6C (COX6C)

Shipped with Ice Packs

In Stock

Cat. No.

BT2037151

Source

in vitro E.coli expression system

Synonyms

COX6C; Cytochrome c oxidase subunit 6C; Cytochrome c oxidase polypeptide VIc

Quick Inquiry

Description

Production and Biochemical Characteristics

COX6C is synthesized via recombinant DNA technology, primarily in E. coli or yeast systems. Key production parameters include:

Parameter	Details	Source
Uniprot ID	Q0Q4Z0
Purity	>85% (SDS-PAGE)
Expression System	E. coli (CSB-EP611310LBU1-B) or yeast (CSB-YP611310LBU1)
Storage	-20°C/-80°C (liquid: 6 months; lyophilized: 12 months)
Buffer	Tris-based buffer with 50% glycerol (default)

Recombinant COX6C is typically partial-length (aa 2–76) and may include affinity tags (e.g., GST, His) depending on the production protocol .

Research Findings and Functional Roles

COX6C’s dysregulation is implicated in mitochondrial dysfunction and cancer progression:

Role in Mitochondrial Function

COX6C is essential for:

Oxidative phosphorylation: Maintains mitochondrial membrane potential (MMP) and electron transport chain efficiency.
Mitochondrial fusion: Deficiency disrupts fusion, impairing ATP production .

Oncogenic Significance

COX6C amplification and overexpression are observed in multiple cancers:

Cancer Type	Mechanism	Outcome
Lung Adenocarcinoma	Copy number amplification at 8q22.2 → ROS accumulation → AMPK activation → Mitotic arrest and apoptosis	Inhibits proliferation; potential biomarker
Breast Cancer	Elevated expression in ER+ subtypes; stabilizes MMP in drug-resistant cells	Promotes survival under hypoxia
Prostate Cancer	Upregulated in tumor tissues; linked to high oxidative respiration rates	Diagnostic marker potential
Uterine Leiomyoma	Fusion with HMGIC/RAD51B → aberrant splicing and tumorigenic signaling	Drives fibroid growth

Knockdown studies in lung adenocarcinoma cells (e.g., H1299) show COX6C depletion induces S-G2/M arrest, polyploidy, and apoptosis via ROS-AMPK signaling .

Applications and Availability

Recombinant COX6C is utilized in:

ELISA kits: For quantifying COX6C levels in biological samples (e.g., CSB-CF611310LBU) .
Structural studies: GST-tagged or His-tagged variants for crystallization or binding assays .

Suppliers include CUSABIO and Creative BioMart, offering products in lyophilized or liquid forms with ≥0.1 mg/mL concentrations .

Clinical and Diagnostic Potential

COX6C’s amplification and overexpression in cancers highlight its utility as:

Prognostic biomarker: Elevated levels correlate with tumor aggressiveness .
Therapeutic target: Inhibiting COX6C may disrupt mitochondrial energy metabolism in cancer cells .

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference when placing the order, and we will prepare accordingly.

Lead Time

Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. If dry ice shipment is required, please communicate with us in advance as additional fees will apply.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Reconstitution

We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point for your convenience.

Shelf Life

Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form maintains stability for 12 months at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type will be determined during the manufacturing process.

The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specifications.

Synonyms

COX6C; Cytochrome c oxidase subunit 6C; Cytochrome c oxidase polypeptide VIc

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

2-76

Protein Length

Full Length of Mature Protein

Species

Vicugna pacos (Alpaca) (Lama pacos)

Target Names

COX6C

Target Protein Sequence

SSGALLPKPQMRGLLAKRLRVHIVGAFVVALGVAAAYKFGVAEPRKKAYADFYRNYDSMK DFEEMRQAGVFQSAK

Uniprot No.

Q0Q4Z0

Target Background

Function

Cytochrome c oxidase subunit 6C (COX6C) is a component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. This respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes collaborate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient across the inner mitochondrial membrane that drives transmembrane transport and the activity of ATP synthase. Cytochrome c oxidase, specifically, catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site within subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Protein Families

Cytochrome c oxidase subunit 6c family

Subcellular Location

Mitochondrion inner membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Lama guanicoe pacos Cytochrome c oxidase subunit 6C (COX6C)

Description

Production and Biochemical Characteristics

Research Findings and Functional Roles

Role in Mitochondrial Function

Oncogenic Significance

Applications and Availability

Clinical and Diagnostic Potential

Product Specs

Target Background

Quick Inquiry

Category

Service