Recombinant Lama guanicoe pacos NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Genetic Background

MT-ND4L belongs to the mitochondrial genome and encodes NADH-ubiquinone oxidoreductase chain 4L, a critical component of the mitochondrial respiratory chain Complex I . The gene is highly conserved across mammalian species, demonstrating its fundamental importance in cellular energy metabolism. In humans, the MT-ND4L gene is located in the mitochondrial DNA from base pair 10,469 to 10,765, producing a protein composed of 98 amino acids with a molecular weight of approximately 11 kDa . While the gene structure remains relatively consistent across species, there are species-specific variations in its sequence and expression patterns.

Origin in Lama guanicoe pacos

Lama guanicoe pacos, commonly known as the alpaca, is a domesticated South American camelid species valued for its fine wool and adaptability to high-altitude environments . The recombinant version of MT-ND4L from this species has recently become available for research purposes, allowing scientists to study the unique characteristics of camelid mitochondrial proteins . The interest in alpaca MT-ND4L stems partly from the species' remarkable adaptation to high-altitude environments with lower oxygen availability, where efficient mitochondrial function plays a crucial role in cellular energy production and oxygen utilization.

Relationship to Other Mitochondrial Genes

MT-ND4L is one of seven mitochondrial genes encoding subunits of the enzyme NADH dehydrogenase (ubiquinone), alongside MT-ND1, MT-ND2, MT-ND3, MT-ND4, MT-ND5, and MT-ND6 . These genes collectively form the core components of Complex I, which is the largest of the respiratory complexes in the mitochondrial electron transport chain. An unusual feature observed in the human MT-ND4L gene (and likely conserved in camelids) is a 7-nucleotide gene overlap with MT-ND4, where the last three codons of MT-ND4L share nucleotides with the first three codons of MT-ND4 . This unique genetic arrangement demonstrates the extreme efficiency of the mitochondrial genome in encoding essential respiratory proteins.

Protein Structure

The recombinant Lama guanicoe pacos MT-ND4L protein consists of 98 amino acids, maintaining the full-length sequence of the native protein . The protein possesses a predominantly hydrophobic character, consistent with its role as a transmembrane component of Complex I. The specific amino acid sequence of the alpaca MT-ND4L is: "MSMVYMNIMLAFTMSLIGLLMYRSHLMSSLLCLEGMMLSLFVMASLMILSTHFTLASMMP IILLVFAACEAALGLALLVMISNTYGTDYVQNLNLLQC" . This sequence reflects the protein's adaptation to function within the lipid bilayer of the inner mitochondrial membrane.

Comparative Analysis with Human MT-ND4L

Comparing the alpaca MT-ND4L with its human counterpart reveals important structural and functional conservation across mammalian species. Both proteins maintain the 98-amino acid length and similar hydrophobic profiles essential for membrane integration . The table below summarizes key comparative features:

FeatureLama guanicoe pacos MT-ND4LHuman MT-ND4L
Length98 amino acids98 amino acids
Molecular Weight~11 kDa~11 kDa
Cellular LocationMitochondrial inner membraneMitochondrial inner membrane
FunctionComponent of Complex IComponent of Complex I
Expression System (recombinant)E. coliVarious
Gene LocationMitochondrial DNAMitochondrial DNA (10,469-10,765 bp)

This high degree of conservation underscores the critical importance of MT-ND4L in mitochondrial function across mammalian species, despite millions of years of evolutionary divergence.

Recombinant Protein Modifications

The commercially available recombinant Lama guanicoe pacos MT-ND4L includes an N-terminal histidine tag (His-tag) to facilitate purification and potentially enhance solubility . This modification allows for efficient isolation of the protein using metal affinity chromatography but may slightly alter certain biochemical properties compared to the native protein. The recombinant version is expressed in Escherichia coli bacterial systems, which provides high yield but may result in differences in post-translational modifications compared to the protein expressed in mammalian mitochondria .

Role in Complex I

MT-ND4L functions as a critical subunit of NADH dehydrogenase (Complex I), which is the first and largest enzyme complex in the mitochondrial electron transport chain . Complex I has an L-shaped structure with a long, hydrophobic transmembrane domain and a hydrophilic peripheral arm containing redox centers and the NADH binding site. MT-ND4L, being highly hydrophobic, forms part of the core of the transmembrane region of this complex . As one of the most hydrophobic subunits, it plays a crucial role in anchoring the complex within the inner mitochondrial membrane.

Electron Transport Function

The MT-ND4L protein contributes to the minimal assembly of core proteins required to catalyze NADH dehydrogenation and electron transfer to ubiquinone (coenzyme Q10) . The electron transport process begins when NADH binds to Complex I and transfers two electrons to the flavin mononucleotide (FMN) prosthetic group. These electrons then move through a series of iron-sulfur clusters before reaching ubiquinone, which is reduced to ubiquinol . This electron flow generates energy that drives the pumping of four hydrogen ions (protons) from the mitochondrial matrix to the intermembrane space, contributing to the proton gradient that ultimately powers ATP synthesis.

Energy Production Significance

The efficient functioning of MT-ND4L and other Complex I components is essential for optimal ATP production through oxidative phosphorylation . By contributing to the establishment of the proton gradient across the inner mitochondrial membrane, MT-ND4L indirectly supports the generation of cellular energy. This function is particularly critical in tissues with high energy demands, such as muscle, brain, and heart, where mitochondrial dysfunction can lead to significant pathological consequences.

Expression Systems

The recombinant Lama guanicoe pacos MT-ND4L protein is produced using Escherichia coli expression systems . This bacterial expression platform allows for high-yield production of the protein in a controlled laboratory environment. The recombinant protein includes a His-tag fusion, typically at the N-terminus, which facilitates purification while maintaining the functional integrity of the protein . The use of E. coli for expression may result in some structural differences compared to the native mitochondrially-produced protein, particularly in terms of post-translational modifications, but the core functional domains are preserved.

Comparative Mitochondrial Studies

Recombinant Lama guanicoe pacos MT-ND4L provides a valuable tool for comparative studies of mitochondrial function across species . By examining the structural and functional similarities and differences between alpaca MT-ND4L and its counterparts in other mammals, researchers can gain insights into the evolutionary conservation of mitochondrial respiratory components. Such comparative analyses can highlight adaptations that may contribute to the alpaca's ability to thrive in high-altitude, low-oxygen environments, where efficient mitochondrial function is particularly crucial.

Respiratory Chain Research

The availability of recombinant MT-ND4L facilitates detailed investigation of Complex I assembly, structure, and function . Researchers can use the purified protein in reconstitution experiments to study the contribution of MT-ND4L to Complex I activity and stability. Additionally, the recombinant protein can serve as a standard in assays designed to measure Complex I function in various experimental contexts, providing a controlled reference point for comparative analyses.

Potential Biotechnological Applications

The unique properties of camelid proteins, including MT-ND4L, may offer advantages for certain biotechnological applications. The thermal stability and potential functional adaptations of proteins from animals evolved to withstand extreme environments (such as high-altitude alpacas) could be harnessed for various industrial and biomedical purposes. While specific applications of recombinant Lama guanicoe pacos MT-ND4L are still emerging, its availability expands the toolkit for researchers exploring camelid-derived proteins for biotechnological innovation.

Insights from Human MT-ND4L Mutations

Studies of human MT-ND4L have revealed important medical implications that may inform research on the alpaca counterpart. In humans, mutations in MT-ND4L have been associated with increased body mass index (BMI) in adults and implicated in metabolic disorders including obesity, diabetes, and hypertension . A specific T>C mutation at position 10,663 in human MT-ND4L is known to cause Leber's Hereditary Optic Neuropathy (LHON), a condition characterized by the sudden onset of blindness due to retinal ganglion cell death . This mutation results in the replacement of valine with alanine at position 65 of the protein, disrupting Complex I function .

Comparative Pathology Potential

The availability of recombinant Lama guanicoe pacos MT-ND4L enables comparative studies that may reveal species-specific vulnerabilities or resistances to mitochondrial dysfunction. By comparing the effects of equivalent mutations in human and alpaca MT-ND4L, researchers could identify structural or functional elements that modify disease susceptibility. Such studies could potentially inform our understanding of mitochondrial disorders and suggest novel approaches for therapeutic intervention based on naturally evolved adaptations in camelid species.

Evolutionary Medicine Perspectives

The study of MT-ND4L across species contributes to the field of evolutionary medicine, which examines how evolutionary processes have shaped health and disease patterns. The alpaca's adaptation to high-altitude environments may have selected for specific variations in mitochondrial proteins, including MT-ND4L, that optimize energy production under hypoxic conditions. Understanding these adaptations could provide insights relevant to human conditions involving tissue hypoxia, such as ischemic heart disease, stroke, or high-altitude sickness.

Functional Characterization

Detailed biochemical and biophysical characterization of recombinant Lama guanicoe pacos MT-ND4L would provide valuable insights into its specific functional properties. Studies examining its interaction with other Complex I subunits, its role in electron transport efficiency, and its contribution to proton pumping could reveal species-specific adaptations that may be relevant to understanding camelid mitochondrial function.

Comparative Genomics and Proteomics

Expanding comparative analyses to include MT-ND4L from multiple camelid species and other mammals adapted to extreme environments could identify convergent or divergent evolutionary solutions to similar environmental challenges. Such studies would contribute to our broader understanding of mitochondrial adaptation and the evolution of cellular energy production systems.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Vicugna pacos (Alpaca) (Lama pacos)
Target Names
Target Protein Sequence
MSMVYMNIMLAFTMSLIGLLMYRSHLMSSLLCLEGMMLSLFVMASLMILSTHFTLASMMP IILLVFAACEAALGLALLVMISNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This enzyme catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as the electron acceptor.

Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MT-ND4L in mitochondrial metabolism?

MT-ND4L (mitochondrially encoded NADH-ubiquinone oxidoreductase chain 4L) serves as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein is essential for the catalytic activity and assembly of Complex I, which functions in the electron transfer process from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. The protein plays a critical role in energy production through oxidative phosphorylation, contributing to ATP synthesis in the cell . As part of Complex I, MT-ND4L helps establish the proton gradient across the inner mitochondrial membrane that drives ATP synthase activity. Its functionality is directly linked to cellular energy metabolism and mitochondrial health .

Where is the MT-ND4L gene located in the camelid mitochondrial genome?

In camelids, the MT-ND4L gene is located on the heavy (H) strand of the mitochondrial genome. According to detailed genomic mapping, in Lama species, the gene spans positions 9894-10190, comprising 297 base pairs with a GC content of 40.74% . The gene begins with the start codon ATG and terminates with the stop codon TAA. Interestingly, the MT-ND4L gene shows an overlap with the downstream ND4 gene by 7 base pairs, a feature commonly observed in the compact mitochondrial genome organization . This gene organization contributes to the efficient expression of the mitochondrial genome and represents an evolutionary adaptation for energy conservation.

What are the optimal storage conditions for recombinant Lama guanicoe pacos MT-ND4L?

For optimal stability and activity retention, recombinant Lama guanicoe pacos MT-ND4L should be stored in a Tris-based buffer containing 50% glycerol, specifically optimized for this protein . Long-term storage should be at -20°C, while extended preservation is best achieved at -80°C. Researchers should avoid repeated freeze-thaw cycles as they can compromise protein integrity and activity . For ongoing experiments, working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw damage. These storage conditions help preserve the native conformation and functional properties of the protein, ensuring reliable and reproducible experimental results. Proper aliquoting of the protein upon receipt is recommended to minimize the need for repeated freezing and thawing of the entire stock.

How can researchers express and purify recombinant MT-ND4L for functional studies?

Expressing and purifying functional MT-ND4L presents several challenges due to its hydrophobic nature and membrane localization. A methodological approach includes:

  • Gene optimization and vector selection: The MT-ND4L gene sequence should be codon-optimized for the expression system (typically E. coli, yeast, or insect cells). Selection of expression vectors with strong but controllable promoters is crucial .

  • Expression system selection: For membrane proteins like MT-ND4L, specialized expression systems such as C41(DE3) or C43(DE3) E. coli strains may yield better results than standard strains.

  • Fusion tags incorporation: Adding solubility-enhancing tags (SUMO, MBP, or GST) at the N-terminus can improve expression yields and solubility. For purification, histidine tags are commonly employed .

  • Induction conditions optimization: Lower temperatures (16-20°C) and reduced inducer concentrations often improve the folding of membrane proteins.

  • Membrane protein extraction: Detergent screening is critical for efficient extraction from membranes. Mild detergents like DDM, LMNG, or digitonin are recommended for maintaining protein structure and function.

  • Purification strategy: A multi-step purification approach typically includes:

    • Affinity chromatography (based on the fusion tag)

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for final polishing

  • Functional validation: Activity assays measuring NADH oxidation rates in the presence of ubiquinone analogs can verify that the purified protein retains its native function .

What PCR-based methods are effective for amplifying and sequencing the MT-ND4L gene?

For effective amplification and sequencing of the MT-ND4L gene, researchers should consider the following PCR-based methodology:

  • Primer design strategy: Design primers based on highly conserved regions flanking the MT-ND4L gene, identified through multiple sequence alignment of related species. For camelids, primers targeting positions around 9894 (forward) and 10190 (reverse) have proven effective .

  • Optimal reaction conditions:

    • Reaction mixture: 1-2 U Taq DNA polymerase, 10 mM Tris-HCl (pH 8.3), 0.25 mM dNTPs, 0.2-2 mM BSA, 1.5-2.5 mM MgCl₂, 20 pM of each primer, and ~10 ng template DNA

    • Thermal cycling: Initial denaturation at 94°C for 5 minutes, followed by 35 cycles of 94°C for 30s, 50°C for 30s, and 72°C for 45s

  • Template preparation: For mitochondrial genes, enrichment of mitochondrial DNA can improve specificity. This can be achieved through differential centrifugation of tissue homogenates.

  • Sequencing approach: Direct Sanger sequencing of PCR products using the same primers as for amplification. For challenging regions, nested PCR may be necessary .

  • Data analysis pipeline:

    • Sequence assembly using software packages like phred/phrap/consed

    • Annotation using BLAST tools

    • tRNA genes identification using tRNAscan-SE

This methodological approach ensures high-quality sequence data for evolutionary and functional studies of MT-ND4L.

How can researchers identify ubiquinone binding sites in MT-ND4L?

Identifying ubiquinone binding sites in MT-ND4L requires specialized techniques that can detect specific protein-substrate interactions. Based on successful approaches with related proteins, the following methodology is recommended:

  • Photoaffinity labeling: Synthesize photoreactive biotinylated ubiquinone mimics with minimal modification of the quinone ring structure. These compounds can form covalent bonds with amino acids at the binding site upon UV irradiation .

  • Cross-linking and fragmentation strategy:

    • Expose the protein to the photoreactive ubiquinone analog under controlled conditions

    • Cleave the labeled protein with CNBr to identify the general region of binding

    • Further digest with specific proteases (e.g., V8 protease and lysylendopeptidase) to narrow down the binding site

  • Mass spectrometry analysis: Analyze the cross-linked peptide fragments using LC-MS/MS to identify the specific amino acids involved in ubiquinone binding.

  • Validation through site-directed mutagenesis: Mutate the identified amino acids and assess changes in ubiquinone binding affinity and enzyme activity.

  • Computational modeling: Employ molecular docking and molecular dynamics simulations to predict the binding mode of ubiquinone. These in silico approaches can complement experimental methods by providing structural insights into the binding interface .

This combinatorial approach has successfully identified ubiquinone binding sites in related proteins, such as the NDH-2-type alternative NADH-quinone oxidoreductase from Saccharomyces cerevisiae, where the binding site was localized to a 26-amino acid region (Gly374-Lys405) .

What phylogenetic analysis methods can reveal evolutionary relationships between camelid MT-ND4L and other species?

Phylogenetic analysis of MT-ND4L can provide valuable insights into camelid evolution and their relationship to other mammals. A comprehensive methodological approach includes:

  • Sequence acquisition and alignment:

    • Obtain MT-ND4L sequences from camelids and other mammals through direct sequencing or database mining

    • Perform multiple sequence alignment using CLUSTAL W or similar tools

    • Manually inspect and refine alignments to ensure homology

  • Evolutionary rate analysis:

    • Estimate variation rates at synonymous (dS) and nonsynonymous (dN) sites using maximum likelihood methods

    • Implement these calculations with software like Ka_Ks_Calculator

  • Phylogenetic tree reconstruction:

    • Apply multiple tree-building algorithms: neighbor-joining (implemented in MEGA) and maximum likelihood (implemented in PHYLIP)

    • Assess branch reliability through bootstrap analysis (1000 replications)

    • Conduct Bayesian posterior probability analysis of phylogeny using MrBayes

  • Molecular clock testing and calibration:

    • Test rate constancy using Tajima's and likelihood ratio tests

    • If rate constancy is rejected (as in camelids), apply relaxed clock models

    • Calibrate the molecular clock using fossil records or geological events

  • Divergence time estimation:

    • Apply a heuristic rate smoothing procedure for ML estimates as implemented in PAML

    • Use appropriate outgroups (e.g., bovine sequences for camelid studies)

This approach has revealed that the two tribes of camelids (Camelini and Lamini) diverged approximately 25 million years ago, significantly earlier than suggested by fossil records . Such analyses provide a framework for understanding the evolutionary history and adaptations of camelids in different environments.

How can MT-ND4L mutations be associated with phenotypic traits or mitochondrial diseases?

Investigating associations between MT-ND4L variants and phenotypic traits or diseases requires robust statistical and experimental approaches:

  • Sample preparation and variant identification:

    • Extract mitochondrial DNA from appropriate tissue samples

    • Sequence the MT-ND4L gene using Sanger sequencing or next-generation sequencing

    • Annotate variants according to the reference sequence (e.g., rCRS for human mitochondrial DNA)

  • Trait measurement and standardization:

    • Collect relevant phenotypic data (e.g., metabolic parameters, disease status)

    • Normalize trait distributions and produce standardized residuals

    • Apply statistical regression models that account for factors like age, sex, and population structure

  • Statistical association testing:

    • Implement association tests at the cohort level

    • For rare variants, consider specialized methods like burden tests or sequence kernel association tests

    • Apply appropriate multiple testing corrections

  • Meta-analysis framework:

    • Harmonize data across multiple cohorts

    • Combine evidence using fixed or random effects models

    • Assess heterogeneity across studies

  • Functional validation of candidate variants:

    • Create cellular models expressing the variant of interest

    • Measure the impact on Complex I activity, electron transfer, and ATP production

    • Assess consequences for mitochondrial membrane potential and reactive oxygen species production

This methodological approach has been successfully applied to identify associations between mitochondrial variants and various phenotypic traits, providing insights into the functional consequences of MT-ND4L mutations .

What AI-driven approaches can be used to predict MT-ND4L structure and dynamics?

Recent advances in artificial intelligence offer powerful tools for studying the structure and dynamics of challenging membrane proteins like MT-ND4L:

  • AI-powered literature mining:

    • Custom-tailored language models can extract and formalize information about MT-ND4L from structured and unstructured data sources

    • This comprehensive analysis provides insights into therapeutic significance, ligand interactions, and protein-protein interactions

  • Conformational ensemble generation:

    • Advanced AI algorithms can predict alternative functional states of MT-ND4L

    • Molecular simulations with AI-enhanced sampling explore the conformational space of the protein

    • Trajectory clustering identifies representative structures that capture the full range of conformational states

  • Diffusion-based modeling:

    • Diffusion-based AI models combined with active learning AutoML generate statistically robust ensembles of protein conformations

    • These ensembles capture the dynamic behavior of MT-ND4L within the lipid bilayer environment

  • Binding pocket identification:

    • AI-based pocket prediction integrates literature data with structure-aware ensemble-based detection algorithms

    • This approach can discover orthosteric, allosteric, hidden, and cryptic binding pockets on the protein surface

    • Newly identified binding sites may represent novel targets for drug development or mechanistic studies

These AI-driven approaches overcome limitations of traditional structural biology methods for membrane proteins, providing insights into MT-ND4L function that would be difficult to obtain through experimental methods alone.

How can researchers study interactions between MT-ND4L and other subunits of Complex I?

Understanding the interactions between MT-ND4L and other Complex I subunits requires specialized techniques for membrane protein complexes:

  • Crosslinking coupled with mass spectrometry:

    • Apply chemical crosslinkers of varying lengths to identify spatial relationships between subunits

    • Digest crosslinked complexes and analyze by mass spectrometry

    • Identify crosslinked peptides to map interaction interfaces

  • Co-immunoprecipitation assays:

    • Use antibodies against MT-ND4L or other Complex I subunits to pull down interaction partners

    • Western blotting or mass spectrometry can identify co-precipitated proteins

    • This approach validates direct interactions within the assembled complex

  • Blue native electrophoresis:

    • Separate intact respiratory complexes under native conditions

    • Subsequent second-dimension SDS-PAGE separates individual subunits

    • Analysis of assembly intermediates in MT-ND4L mutants can reveal its role in complex assembly

  • Proximity labeling approaches:

    • Express MT-ND4L fused to enzymes like BioID or APEX2

    • These enzymes biotinylate nearby proteins, which can then be purified and identified

    • This method captures transient and stable interactions in the native cellular environment

  • Cryo-electron microscopy:

    • Single-particle cryo-EM can resolve the structure of intact Complex I

    • Focused refinement on the MT-ND4L region provides detailed structural information

    • Comparison of structures with and without substrates or inhibitors reveals dynamic changes

These complementary approaches provide a comprehensive view of how MT-ND4L integrates into Complex I and contributes to its function in the electron transport chain.

How does Lama guanicoe pacos MT-ND4L compare with orthologs from other species?

Comparative analysis of MT-ND4L across species reveals important insights about evolutionary conservation and functional adaptation:

  • Sequence conservation analysis:

    MT-ND4L shows varying degrees of conservation across mammalian species, reflecting both functional constraints and evolutionary adaptations. Key comparisons include:

    SpeciesSequence Identity with Lama guanicoe pacosGC ContentGene Length (bp)
    Lama guanicoe pacos (Alpaca)100%40.74%297
    Camelus bactrianus (Bactrian camel)~85-90%*Similar297
    Homo sapiens (Human)~70-75%*Similar297
    Bos taurus (Cow)~70-75%*Similar297

    *Estimated from comparative studies

  • Structural features comparison:

    • Transmembrane domain organization is highly conserved across species

    • The ubiquinone binding regions show higher conservation than peripheral regions

    • Species-specific variations are predominantly in loops connecting transmembrane segments

  • Functional domain conservation:

    • Residues involved in proton pumping are highly conserved

    • Electron transfer pathway components show strong evolutionary constraints

    • Species-specific adaptations may reflect metabolic requirements in different environments

  • Evolutionary rate analysis:

    • MT-ND4L evolves at different rates in different lineages

    • Tajima's relative rate test rejected the assumption of a constant rate of change among camelid mitochondrial genomes (p < 0.01)

    • This differential evolutionary rate provides insights into selective pressures acting on MT-ND4L in various environments

The comparative analysis suggests that while MT-ND4L maintains its core functionality across species, specific adaptations have occurred during evolution to optimize energy metabolism for particular ecological niches .

What role does MT-ND4L play in camelid phylogenetic studies?

MT-ND4L, as part of the mitochondrial genome, provides valuable information for camelid phylogenetic studies:

The comprehensive phylogenetic analysis of camelid MT-ND4L provides a molecular framework for understanding the evolutionary history of these economically and ecologically important mammals .

What are the common challenges in working with recombinant MT-ND4L and how can they be addressed?

Working with recombinant MT-ND4L presents several technical challenges due to its hydrophobic nature and integral membrane protein characteristics:

  • Low expression yields:

    • Challenge: Hydrophobic membrane proteins often express poorly in conventional systems

    • Solution: Use specialized expression strains (C41/C43), lower induction temperatures (16-20°C), and optimize codon usage for the expression host

  • Protein aggregation:

    • Challenge: MT-ND4L tends to form inclusion bodies or aggregates during expression

    • Solution: Co-express with chaperones, use solubility-enhancing fusion tags (SUMO, MBP), and optimize buffer conditions with mild detergents or amphipols

  • Protein instability:

    • Challenge: Once purified, MT-ND4L may rapidly lose activity or structural integrity

    • Solution: Maintain in appropriate detergent micelles or reconstitute into nanodiscs/liposomes, include stabilizing agents (glycerol, specific lipids), and minimize exposure to oxidizing conditions

  • Functional assessment difficulties:

    • Challenge: Assessing electron transfer activity in isolation is technically demanding

    • Solution: Develop coupled enzyme assays that monitor NADH oxidation in the presence of ubiquinone analogs, or reconstitute with minimal partner proteins needed for activity

  • Structural characterization limitations:

    • Challenge: Traditional structural biology methods are challenging to apply to small membrane proteins

    • Solution: Utilize newer technologies like cryo-EM of reconstituted complexes, solid-state NMR in lipid environments, and AI-driven structural prediction approaches

By implementing these technical solutions, researchers can overcome many of the inherent challenges associated with studying recombinant MT-ND4L, enabling more comprehensive functional and structural analyses.

How can researchers validate the functional integrity of recombinant MT-ND4L?

Validating the functional integrity of recombinant MT-ND4L requires multiple complementary approaches:

  • Spectroscopic characterization:

    • UV-visible spectroscopy to confirm proper folding and cofactor incorporation

    • Circular dichroism to assess secondary structure composition and thermal stability

    • Fluorescence spectroscopy to monitor structural changes upon substrate binding

  • Activity assays:

    • NADH oxidation rates in the presence of ubiquinone analogs (measured spectrophotometrically at 340 nm)

    • Oxygen consumption measurements using oxygen electrodes when reconstituted with other respiratory chain components

    • Electron transfer to artificial electron acceptors like ferricyanide or dichlorophenolindophenol

  • Binding assays:

    • Isothermal titration calorimetry to measure binding affinity for substrates and inhibitors

    • Surface plasmon resonance to evaluate interaction kinetics

    • Fluorescence quenching assays using fluorescent ubiquinone analogs

  • Membrane incorporation assessment:

    • Proteoliposome reconstitution efficiency

    • Proper orientation in membrane mimetic systems

    • Lipid composition effects on activity and stability

  • Interaction with partner proteins:

    • Co-immunoprecipitation with other Complex I subunits

    • Blue native PAGE to assess incorporation into higher-order complexes

    • Functional complementation in cellular systems with MT-ND4L deficiency

These validation approaches ensure that recombinant MT-ND4L maintains its native-like structure and function, providing confidence in subsequent mechanistic and structural studies.

What emerging technologies show promise for advancing MT-ND4L research?

Several cutting-edge technologies are poised to revolutionize our understanding of MT-ND4L structure, function, and role in disease:

  • Cryo-electron microscopy advances:

    • Technological improvements in detectors and processing algorithms now enable structural determination of membrane protein complexes at near-atomic resolution

    • Time-resolved cryo-EM can potentially capture different conformational states during the catalytic cycle

  • AI-driven structural prediction and dynamics:

    • Deep learning approaches like AlphaFold and RoseTTAFold are increasingly accurate for membrane protein structural prediction

    • AI-enhanced molecular dynamics simulations can explore conformational landscapes inaccessible to conventional methods

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) at the single-molecule level can track conformational changes during electron transfer

    • Optical tweezers combined with electrical recordings can correlate mechanical changes with proton pumping activity

  • Genome editing in model organisms:

    • CRISPR-Cas9 approaches that can target mitochondrial DNA would enable precise engineering of MT-ND4L variants

    • This would facilitate direct assessment of variant effects in cellular and organismal contexts

  • Systems biology integration:

    • Multi-omics approaches combining proteomics, metabolomics, and transcriptomics can provide comprehensive views of MT-ND4L function in cellular metabolism

    • Network analysis can reveal unexpected connections between MT-ND4L and other cellular processes

  • Nanoscale imaging:

    • Super-resolution microscopy techniques can visualize MT-ND4L distribution and dynamics in living cells

    • Correlative light and electron microscopy can connect functional states with structural features

These emerging technologies promise to overcome long-standing technical barriers in MT-ND4L research, potentially leading to breakthroughs in understanding mitochondrial function and disease mechanisms.

What are the most promising applications of MT-ND4L research in mitochondrial medicine?

Research on MT-ND4L has significant implications for advancing mitochondrial medicine in several areas:

  • Mitochondrial disease diagnostics:

    • Improved understanding of MT-ND4L variants can enhance genetic diagnosis of mitochondrial disorders

    • Functional characterization of variants can help distinguish pathogenic mutations from benign polymorphisms

    • This knowledge can inform genetic counseling and reproductive options for affected families

  • Pharmacological interventions:

    • Detailed understanding of MT-ND4L structure and function enables rational design of compounds that can:

      • Bypass dysfunctional Complex I in patients with MT-ND4L mutations

      • Stabilize partially functional MT-ND4L variants to improve residual activity

      • Reduce harmful reactive oxygen species production associated with MT-ND4L dysfunction

  • Gene therapy approaches:

    • Allotopic expression of engineered MT-ND4L genes from the nuclear genome can potentially complement mitochondrial mutations

    • RNA-based therapies might shift heteroplasmy levels in favor of wildtype MT-ND4L

    • Mitochondrially targeted nucleases could selectively eliminate mutant mitochondrial DNA containing MT-ND4L mutations

  • Biomarker development:

    • Metabolic signatures associated with MT-ND4L dysfunction can serve as biomarkers for:

      • Disease progression monitoring

      • Treatment response assessment

      • Early detection of mitochondrial dysfunction

  • Precision medicine strategies:

    • Patient-specific cellular models harboring MT-ND4L mutations can be used for:

      • Personalized drug screening

      • Evaluation of novel therapeutic approaches

      • Understanding tissue-specific effects of mutations

These research applications have potential to transform management of mitochondrial diseases linked to MT-ND4L dysfunction, moving from purely supportive care to targeted therapeutic interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.