Recombinant Lampetra japonica Rhodopsin (RHO)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Lampetra japonica RHO is produced using an E. coli expression system and purified as a transmembrane protein with a full-length sequence of 353 amino acids . Key structural and biochemical properties include:

PropertyDetail
UniProt IDP22671
Expression SystemE. coli (in vitro)
TagN-terminal 10xHis-tag
Storage-20°C (short-term); -80°C (long-term)
Sequence Region1-353
Chromophore BindingRequires 11-cis-retinal for reconstitution

The protein features seven transmembrane domains, characteristic of G-protein-coupled receptors (GPCRs), and binds 11-cis-retinal covalently via a Schiff base linkage to Lys296 .

Functional Properties

  • Absorption Spectrum: Reconstituted recombinant Lampetra japonica RHO exhibits an absorption maximum at 500 nm, similar to native lamprey rhodopsin extracted from retinal tissues .

  • Stability: Unlike mammalian rhodopsins, it bleaches gradually in the presence of hydroxylamine (100 mM) even in darkness, indicating weaker retinal binding .

  • Immunoreactivity: Reacts with anti-bovine rhodopsin antibodies (e.g., Rh29), confirming structural conservation across species .

Evolutionary Studies

Lamprey rhodopsin provides insights into early vertebrate vision evolution. Its structural similarities to bovine rhodopsin (e.g., seven transmembrane helices, conserved lysine residue for retinal binding) highlight functional conservation, while differences in stability reflect evolutionary divergence .

Disease Modeling

  • Retinitis Pigmentosa (RP): Mutations in RHO account for 25–30% of autosomal dominant RP cases . Studies using recombinant RHO explore mechanisms like protein misfolding and endoplasmic reticulum (ER) stress, which trigger photoreceptor apoptosis .

  • Pharmacological Chaperones: Compounds like YC-001 improve trafficking of misfolded RHO mutants to cell membranes, offering therapeutic potential .

Table: Key Studies on Recombinant Lampetra japonica RHO

StudyMethodOutcomeSource
Recombinant ExpressioncDNA cloning in 293S cellsSuccessfully expressed functional RHO with 500 nm absorbance peak
Retinal Binding AnalysisHydroxylamine bleaching assayIdentified unstable retinal binding compared to mammalian rhodopsins
Structural ModelingAnti-bovine antibody reactivityConfirmed conserved epitopes between lamprey and mammalian rhodopsins

Technical Considerations

  • Storage: Repeated freeze-thaw cycles degrade the protein; working aliquots stored at 4°C retain stability for one week .

  • Activity Assays: Requires reconstitution with 11-cis-retinal for functional studies .

Future Directions

Research priorities include:

  1. Mechanistic Studies: Elucidating conformational changes during photoactivation using cryo-EM .

  2. Therapeutic Development: Optimizing pharmacological chaperones to stabilize RHO mutants in RP .

  3. Comparative Biology: Exploring adaptive variations in retinal binding among agnathan vertebrates .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Our standard shipping method includes normal blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You can use this as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
RHO; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Lethenteron camtschaticum (Japanese lamprey) (Lampetra japonica)
Target Names
RHO
Target Protein Sequence
MNGTEGDNFYVPFSNKTGLARSPYEYPQYYLAEPWKYSALAAYMFFLILVGFPVNFLTLF VTVQHKKLRTPLNYILLNLAMANLFMVLFGFTVTMYTSMNGYFVFGPTMCSIEGFFATLG GEVALWSLVVLAIERYIVICKPMGNFRFGNTHAIMGVAFTWIMALACAAPPLVGWSRYIP EGMQCSCGPDYYTLNPNFNNESYVVYMFVVHFLVPFVIIFFCYGRLLCTVKEAAAAQQES ASTQKAEKEVTRMVVLMVIGFLVCWVPYASVAFYIFTHQGSDFGATFMTLPAFFAKSSAL YNPVIYILMNKQFRNCMITTLCCGKNPLGDDESGASTSKTEVSSVSTSPVSPA
Uniprot No.

Target Background

Function
Rhodopsin is a photoreceptor essential for image-forming vision in low light conditions. While most saltwater fish species utilize retinal as a chromophore, most freshwater fish use 3-dehydroretinal or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling through G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin, ultimately terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.
Tissue Specificity
Short photoreceptor cells.

Q&A

What is the structural organization of rhodopsin in Lampetra japonica compared to other vertebrates?

Lampetra japonica (river lamprey) rhodopsin is a photoreceptor protein that functions as the primary visual pigment in rod cells. Structurally, it consists of the protein component opsin coupled with the chromophore retinal. In lamprey retina, rod-opsin immunoreactivity is specifically localized to the outer segments of rod photoreceptor cells, which are vitreadly positioned in the outer nuclear layer . This organization is consistent with the general pattern observed across vertebrates, supporting the evolutionary conservation of rhodopsin structure. The immunocytochemical studies using antisera against rod-opsin clearly differentiate it from cone-specific proteins like visinin, which is found in scleradly located structures . This distinction provides valuable evidence for the presence of both rod and cone photoreceptor systems in this early vertebrate lineage.

How can researchers distinguish between rhodopsin expression in different tissues of Lampetra japonica?

Researchers can employ immunocytochemical approaches using specific antisera against photoreceptor proteins to distinguish rhodopsin expression in different lamprey tissues. In the retina, rod-opsin immunoreactivity is confined to the outer segments of rod cells, while in the pineal complex, the pattern is more complex. The pineal end-vesicle contains photoreceptor-like cells with rod-opsin immunoreactive outer segments that protrude into the pineal lumen . Notably, the proximal portion of the pineal organ (atrium) lacks rod-opsin immunoreactive outer segments . Double immunostaining techniques are particularly effective for evaluating co-localization patterns. For example, this approach has revealed that most rod-opsin-immunoreactive outer segments in the pineal end-vesicle belong to serotonin-immunonegative photoreceptors, while serotonin-immunoreactive cells in this region typically possess short rod-opsin-immunoreactive outer segments . These distinct expression patterns help researchers characterize the functional specialization of photoreceptor cells across different tissues.

What are the optimal immunocytochemical methods for detecting Lampetra japonica rhodopsin in tissue samples?

For optimal detection of Lampetra japonica rhodopsin in tissue samples, immunocytochemical approaches using highly specific antisera against rod-opsin have proven most effective. Researchers should consider the following methodological guidelines:

  • Tissue preparation: Fresh tissue should be fixed with appropriate fixatives that preserve antigenic properties while maintaining structural integrity.

  • Antibody selection: Antisera against rod-opsin (the apoprotein of rhodopsin) provide specific markers for rhodopsin-containing structures. For comparative studies, concurrent use of antisera against other photoreceptor proteins (e.g., S-antigen and visinin) enables differentiation between photoreceptor subtypes .

  • Double immunostaining: This technique is essential for co-localization studies, allowing researchers to determine whether multiple proteins exist within the same cells. This approach has been particularly valuable in distinguishing different photoreceptor populations in the lamprey pineal complex .

  • Detection methods: Fluorescence microscopy has been successfully employed to visualize immunoreactive structures in lamprey photoreceptors, allowing clear discrimination between different cell types and their components .

  • Controls: Appropriate controls, including omission of primary antibodies and pre-absorption with purified antigens, are crucial for confirming specificity of immunoreactivity.

These methods have successfully revealed distinct patterns of rhodopsin distribution in lamprey tissues, supporting functional and evolutionary analyses of photoreceptor systems.

What expression systems are most effective for producing recombinant Lampetra japonica rhodopsin for structural and functional studies?

While the search results don't provide direct information on expression systems specifically for Lampetra japonica rhodopsin, researchers can apply established methodologies used for other recombinant proteins from this species. Based on successful approaches for other lamprey proteins, the following expression systems should be considered:

The choice of expression system should be guided by the specific research objectives, whether functional characterization, structural analysis, or antibody production. Gene codon optimization for the chosen expression system is advisable given the evolutionary distance between lampreys and common laboratory organisms.

How does Lampetra japonica rhodopsin differ from mammalian rhodopsins at the sequence and functional levels?

Lampetra japonica rhodopsin represents an evolutionarily ancient form of this visual pigment, offering insights into the ancestral characteristics of vertebrate rhodopsins. While the search results don't provide direct sequence comparisons, several inferences can be made from related studies:

When conducting comparative analyses, researchers should be mindful of these differences and consider methodological approaches that account for potential biases in sequence-based comparisons.

What does the expression pattern of rhodopsin in Lampetra japonica reveal about the evolution of vertebrate visual systems?

The expression patterns of rhodopsin in Lampetra japonica provide crucial evidence regarding the early evolution of vertebrate visual systems:

  • Dual photoreceptor system: The identification of both rod-opsin and visinin (cone marker) immunoreactive photoreceptors in lamprey retina indicates that the fundamental division between rod and cone photoreceptor systems was established early in vertebrate evolution . This supports the hypothesis that duplex retina (containing both rods and cones) is an ancestral vertebrate characteristic.

  • Pineal photoreception: The presence of rhodopsin in the pineal complex of lamprey suggests that extraretinal photoreception through rhodopsin-based mechanisms represents an ancient feature of vertebrates . The differential distribution of rhodopsin and other photoreceptor proteins in the pineal complex provides evidence for specialized photosensory functions in this structure from early evolutionary stages.

  • Multiple photoreceptor cell lines: Immunocytochemical studies have revealed multiple cell lines of the photoreceptor type in the lamprey pineal complex, with varying patterns of serotonin and rhodopsin immunoreactivity . This diversity suggests that functional specialization of photoreceptor cells was already established in early vertebrates.

  • Evolutionary continuity: The ability to identify homologous photoreceptor populations across lampreys and higher vertebrates using the same molecular markers (rod-opsin, S-antigen, visinin) demonstrates the evolutionary continuity of these systems and their molecular components . This supports gradual evolutionary refinement rather than dramatic reinvention of visual systems during vertebrate evolution.

These findings collectively establish lampreys as crucial models for understanding the ancestral state of vertebrate visual systems and the subsequent evolutionary modifications that led to the diverse array of visual adaptations in modern vertebrates.

What are the key methodological challenges in producing functional recombinant Lampetra japonica rhodopsin for spectroscopic studies?

Producing functional recombinant Lampetra japonica rhodopsin for spectroscopic studies presents several methodological challenges that researchers must address:

  • Membrane protein expression: As an integral membrane protein with seven transmembrane domains, rhodopsin requires lipid environments for proper folding and function. Expression systems must be carefully selected to ensure correct membrane insertion and tertiary structure formation.

  • Chromophore attachment: Functional rhodopsin requires proper conjugation with 11-cis-retinal. Protocols must be developed for efficient reconstitution of the apoprotein with the chromophore under conditions that prevent isomerization or oxidation of the retinal.

  • Post-translational modifications: Native rhodopsin undergoes several post-translational modifications including glycosylation and palmitoylation. Expression systems should be capable of performing these modifications for functional studies.

  • Protein stability: Rhodopsin is notably sensitive to detergent conditions and light exposure. Careful selection of solubilization methods and handling under dim red light are essential for maintaining functional integrity.

  • Spectroscopic characterization: Specialized equipment and methodologies for UV-visible and fluorescence spectroscopy under conditions that prevent photobleaching are required for accurate characterization of absorption maxima and photochemical properties.

While the search results don't provide specific methodologies for recombinant lamprey rhodopsin production, researchers can adapt techniques that have been successful with other vertebrate rhodopsins, with adjustments accounting for the distinctive properties of the lamprey protein.

How should researchers address potential biases in phylogenetic analyses involving Lampetra japonica rhodopsin sequences?

Phylogenetic analyses involving Lampetra japonica rhodopsin sequences require careful methodological considerations to avoid potential biases, as highlighted in studies of vertebrate rhodopsin evolution :

  • Base composition bias: Researchers should be aware that vertebrate rhodopsin sequences can exhibit biases in base composition that may lead to spurious phylogenetic reconstructions. Methods that account for compositional heterogeneity, such as LogDet distance methods or maximum-likelihood approaches that allow for nonstationary changes in base composition, should be employed .

  • Codon usage considerations: Studies have identified potential biases associated with codons encoding hydrophobic residues (isoleucine, leucine, and valine). For critical phylogenetic questions, researchers might consider excluding third codon positions or these specific codons, though this approach may reduce phylogenetic signal for other parts of the tree .

  • Taxon sampling: Increased taxon sampling, particularly by including species with intermediate levels of base composition and codon bias, has been shown to improve phylogenetic reconstructions involving rhodopsin sequences . For studies involving lamprey rhodopsin, researchers should ensure adequate sampling of cyclostome and early-diverging gnathostome lineages.

  • Model selection: Employing appropriate evolutionary models that account for the distinctive features of rhodopsin evolution is essential. Testing multiple models and using model selection criteria to identify the most suitable approach is recommended.

  • Partition strategies: Considering separate evolutionary models for different codon positions or functional domains may improve phylogenetic inference by accounting for heterogeneous evolutionary processes across the gene.

By implementing these methodological refinements, researchers can minimize biases and improve the reliability of evolutionary inferences based on lamprey rhodopsin sequences.

What methods are most effective for determining the spectral properties of Lampetra japonica rhodopsin?

Determining the spectral properties of Lampetra japonica rhodopsin requires specialized approaches optimized for photosensitive membrane proteins. Based on standard methodologies in visual pigment research, the following techniques are recommended:

  • UV-Visible absorption spectroscopy: This fundamental technique allows determination of the absorption maximum (λmax) of the dark-adapted pigment and monitoring of spectral shifts upon photoactivation. Samples should be prepared in appropriate detergent micelles or nanodiscs that maintain protein stability.

  • Microspectrophotometry: For in situ measurements of absorption spectra in native photoreceptor cells, microspectrophotometry permits analysis of rhodopsin spectral properties within their natural membrane environment. This approach has been valuable for comparing rod and cone visual pigments in lamprey retina.

  • Fluorescence spectroscopy: Monitoring changes in intrinsic tryptophan fluorescence upon photoactivation provides insights into conformational changes associated with rhodopsin function.

  • Circular dichroism (CD) spectroscopy: CD spectroscopy can provide information about the secondary structure of rhodopsin and structural changes associated with photoactivation or interaction with signaling partners.

  • Resonance Raman spectroscopy: This technique is particularly valuable for characterizing the chromophore-protein interactions and conformational changes in the retinal moiety upon photoactivation.

For all spectroscopic approaches, careful sample handling under dim red light conditions is essential to prevent unintended photoactivation. Comparative analyses with well-characterized rhodopsins from other species would provide valuable context for interpreting the spectral properties of lamprey rhodopsin.

How can researchers effectively study the interaction between Lampetra japonica rhodopsin and its downstream signaling partners?

Studying the interactions between Lampetra japonica rhodopsin and its downstream signaling partners requires approaches that maintain functional integrity while enabling sensitive detection of protein-protein interactions. Recommended methodologies include:

  • Co-immunoprecipitation assays: Using antibodies against lamprey rhodopsin to pull down associated proteins from native tissue extracts, followed by mass spectrometry identification of binding partners.

  • GST pull-down assays: Expressing specific domains of lamprey rhodopsin (particularly the cytoplasmic loops and C-terminus) as GST fusion proteins for in vitro binding studies with potential interaction partners.

  • Surface plasmon resonance (SPR): For quantitative kinetic analysis of rhodopsin interactions with purified signaling proteins, SPR provides real-time binding data and affinity constants.

  • Bioluminescence resonance energy transfer (BRET): By creating fusion proteins with appropriate donor and acceptor tags, BRET enables monitoring of rhodopsin-partner interactions in living cells.

  • Functional assays: Measuring downstream effects such as G-protein activation (GTPγS binding assays), cGMP phosphodiesterase activity, or calcium flux in reconstituted systems provides functional validation of putative interactions.

  • Comparative analysis: Given the evolutionary conservation of visual transduction pathways, information about rhodopsin signaling in other vertebrates can guide identification of potential interaction partners in lamprey.

These approaches would elucidate the degree of conservation in phototransduction mechanisms between lampreys and other vertebrates, potentially revealing ancestral features of visual signaling systems.

How does the distribution of rhodopsin in Lampetra japonica compare with other vertebrate species?

The distribution of rhodopsin in Lampetra japonica shows both conserved and distinctive features when compared with other vertebrates. The following table summarizes key comparative findings:

Tissue/StructureLampetra japonicaTeleost FishAmphibiansMammals
Retinal RodsRod-opsin immunoreactivity in outer segments Rod-opsin in outer segmentsRod-opsin in outer segmentsRod-opsin in outer segments
Retinal ConesNo rod-opsin immunoreactivity; visinin-positive No rod-opsin; cone opsins presentNo rod-opsin; cone opsins presentNo rod-opsin; cone opsins present
Pineal End-vesicleRod-opsin immunoreactive outer segments in photoreceptor-like cells Rod-opsin in photoreceptor cellsVaries by speciesMinimal or absent rhodopsin expression
Pineal AtriumNo rod-opsin immunoreactive outer segments Variable expressionVariable expressionNot applicable
Parapineal OrganRod-opsin immunoreactive outer segments Present in some speciesVariable presenceAbsent in most mammals

This comparative distribution highlights the conservation of basic rhodopsin localization patterns in retinal photoreceptors across vertebrate evolution, while revealing differential expression in extraretinal photoreceptive structures. The presence of rhodopsin-expressing photoreceptors in the pineal complex of lamprey represents an ancestral vertebrate feature that has been modified or lost in some lineages, particularly mammals. These findings support the concept that photoreceptive functions were more widely distributed in early vertebrates, with subsequent specialization and restriction in certain lineages.

What are the key research findings about co-localization of rhodopsin with other proteins in Lampetra japonica photoreceptors?

Immunocytochemical studies have revealed important patterns of co-localization between rhodopsin and other proteins in Lampetra japonica photoreceptors, providing insights into their functional specialization. The following table summarizes key co-localization findings:

Photoreceptor LocationRhodopsin (Rod-opsin)S-antigenSerotoninFunctional Implications
Retinal Rod CellsStrong immunoreactivity in outer segments PositiveNegativeClassical phototransduction
Retinal Cone CellsNegative VariableNegativeColor vision functions
Pineal End-vesicle Photoreceptors (Type 1)Positive in outer segments Strong positiveNegativePrimarily photosensory function
Pineal End-vesicle Photoreceptors (Type 2)Short positive outer segments VariablePositiveDual photosensory and neuroendocrine function
Pineal Atrium CellsNegative Weak positiveStrong positivePrimarily neuroendocrine function
Parapineal PhotoreceptorsPositive in outer segments PositiveVariablePhotosensory function

These co-localization patterns reveal important functional subdivisions within lamprey photoreceptor populations. Most notably, the differential expression of rhodopsin and serotonin (the precursor of melatonin) in photoreceptor subtypes suggests specialized roles in photoreception versus photoneuroendocrine signaling. The finding that "most of the rod-opsin-immunoreactive outer segments in the end-vesicle belonged to serotonin-immunonegative photoreceptors" particularly highlights this functional segregation.

The presence of cells with both photoreceptor (rhodopsin-positive) and neuroendocrine (serotonin-positive) characteristics provides evidence for the evolutionary origins of the vertebrate circadian system, suggesting that the dual sensory/secretory role of the pineal complex was established early in vertebrate evolution.

What are the most promising approaches for studying the molecular evolution of rhodopsin using Lampetra japonica as a model?

Lampetra japonica represents a valuable model for understanding the molecular evolution of rhodopsin due to its position as an extant representative of early vertebrate lineages. The following approaches offer promising avenues for future research:

  • Ancestral sequence reconstruction: Computational approaches incorporating rhodopsin sequences from lampreys alongside those from diverse vertebrates can enable reconstruction of ancestral vertebrate rhodopsin sequences. These reconstructed sequences could then be experimentally synthesized and characterized to understand the functional properties of early vertebrate rhodopsins.

  • Structure-function studies: Site-directed mutagenesis of specific residues in lamprey rhodopsin to match corresponding positions in other vertebrates would help identify key adaptations in rhodopsin evolution. Particular focus should be placed on residues involved in spectral tuning, G-protein interaction, and activation kinetics.

  • Comparative genomics: Analysis of the genomic context of the rhodopsin gene in lamprey compared to other vertebrates could reveal patterns of regulatory evolution and potential gene duplication events important for understanding visual pigment diversification.

  • Developmental expression analysis: Studying the temporal expression patterns of rhodopsin during lamprey development could provide insights into the ontogenetic recapitulation of evolutionary processes in visual system development.

  • Addressing phylogenetic biases: Implementing the methodologies described in section 4.2 to overcome biases in molecular evolutionary analyses would improve our understanding of rhodopsin evolution. This includes careful taxon sampling and appropriate model selection for rhodopsin sequence analysis .

These approaches would collectively contribute to a more comprehensive understanding of how the vertebrate visual system evolved from the ancestral condition represented in extant lampreys.

What are the critical considerations for designing CRISPR/Cas9 experiments targeting Lampetra japonica rhodopsin genes?

While CRISPR/Cas9 technology offers powerful tools for functional genomics, applying this approach to Lampetra japonica rhodopsin genes presents unique challenges that researchers should address:

  • Genome information: Ensure access to accurate genome assemblies and annotation for Lampetra japonica to properly identify rhodopsin gene sequences, potential paralogs, and flanking regulatory regions. Confirm target sequences through independent sequencing.

  • gRNA design considerations:

    • Account for potential GC content biases in lamprey genomes when designing guide RNAs

    • Perform thorough off-target analysis considering lamprey-specific repetitive elements

    • Design multiple gRNAs targeting different exons to increase success probability

  • Delivery methods: Develop appropriate methods for delivering CRISPR/Cas9 components to lamprey embryos or cell systems. Microinjection protocols may need optimization for lamprey eggs, which differ from model organisms.

  • Functional validation:

    • Design assays to verify editing efficiency in lamprey tissues

    • Develop immunohistochemical or spectroscopic methods to confirm rhodopsin protein alterations

    • Consider establishing lamprey cell lines for preliminary testing

  • Phenotypic analysis: Plan appropriate behavioral, electrophysiological, or immunohistochemical assays to characterize visual function alterations in edited lampreys.

  • Ethical and regulatory considerations: Address any specific regulations regarding genetic modification of lamprey species, particularly considering their conservation status in some regions.

  • Control experiments: Include appropriate controls, such as targeting non-essential genes with known phenotypes, to validate the CRISPR system in this non-model organism.

These considerations acknowledge the technical challenges of applying modern genomic tools to evolutionary ancient organisms while maximizing the potential for meaningful insights into rhodopsin function and evolution.

What are common challenges in expressing recombinant Lampetra japonica rhodopsin, and how can they be addressed?

Researchers working with recombinant Lampetra japonica rhodopsin frequently encounter several technical challenges. The following table outlines common issues and recommended solutions:

ChallengePotential CausesRecommended Solutions
Low expression levelsCodon bias incompatibility with expression hostOptimize codons for expression system; try multiple expression hosts
Toxicity to host cellsUse inducible expression systems; reduce induction strength
Inefficient transcriptionTest different promoters; optimize 5' UTR
Protein misfoldingInadequate membrane integrationUse membrane-based expression systems; add solubilization tags
Incorrect disulfide bond formationInclude appropriate oxidoreductases; optimize redox environment
Improper glycosylationSelect expression systems with appropriate glycosylation machinery
Chromophore binding issuesLimited 11-cis-retinal availabilitySupplement with exogenous chromophore; optimize reconstitution conditions
Protein denaturation during reconstitutionPerform reconstitution under dim red light; optimize detergent conditions
Degradation during purificationProtease sensitivityInclude appropriate protease inhibitors; minimize purification time
Light-induced destabilizationPerform all steps under dim red light; use antioxidants
AggregationHydrophobic domain exposureScreen different detergents; consider nanodiscs or amphipols
Concentration-dependent effectsOptimize protein concentration; add stabilizing agents

By systematically addressing these challenges, researchers can improve yields of functional recombinant lamprey rhodopsin for structural and functional studies. Iterative optimization of expression conditions and purification protocols will likely be necessary to accommodate the specific properties of this evolutionarily ancient visual pigment.

How can researchers optimize immunohistochemical protocols for detecting rhodopsin in Lampetra japonica tissues?

Optimizing immunohistochemical protocols for detecting rhodopsin in Lampetra japonica tissues requires careful attention to multiple experimental parameters. Based on successful approaches documented in the literature , the following optimization strategies are recommended:

  • Tissue fixation and processing:

    • Test multiple fixation protocols (e.g., paraformaldehyde concentrations of 2-4%, with/without glutaraldehyde)

    • Optimize fixation duration to balance antigen preservation and tissue penetration

    • Consider antigen retrieval methods if conventional fixation reduces immunoreactivity

    • Evaluate cryoprotection and sectioning thickness (typically 10-20 μm for good resolution)

  • Antibody selection and validation:

    • Test antisera against conserved rhodopsin epitopes from multiple species

    • Validate antibody specificity using Western blot analysis of lamprey retinal extracts

    • Consider developing lamprey-specific antibodies if cross-reactivity is limited

    • For double-labeling studies, ensure primary antibodies are raised in different species

  • Signal detection optimization:

    • Compare different detection systems (direct fluorescence, avidin-biotin amplification)

    • Titrate antibody concentrations to maximize signal-to-noise ratio

    • Optimize incubation times and temperatures

    • Include appropriate blocking steps to reduce non-specific binding

  • Controls:

    • Include positive controls (known rhodopsin-expressing tissues)

    • Perform negative controls (omission of primary antibody)

    • Consider pre-absorption controls with purified antigens

    • Include comparative tissues from other species for reference

  • Microscopy and imaging:

    • Select appropriate filter sets for fluorescence detection

    • Consider confocal microscopy for co-localization studies

    • Document both low and high magnification images to contextualize findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.