Recombinant Langat virus Genome polyprotein

Shipped with Ice Packs
In Stock

Description

Definition and Genomic Organization

The Recombinant Langat Virus (LGTV) Genome Polyprotein is a genetically engineered version of the single large polyprotein encoded by the LGTV RNA genome. LGTV, a member of the Flaviviridae family (genus Flavivirus), has a positive-sense RNA genome of ~11 kb. This genome contains a single open reading frame (ORF) flanked by 5′- and 3′-terminal non-coding regions (NCRs). The ORF is translated into a polyprotein that is co- and post-translationally cleaved by viral and host proteases into three structural proteins (C, prM, E) and seven non-structural proteins (NS1, NS2A, NS2B, NS3, NS4A, NS4B, NS5) . Recombinant constructs often involve chimeric genomes combining LGTV sequences with those of related viruses (e.g., dengue virus or tick-borne encephalitis virus) to study replication mechanisms or attenuation .

Replication and Polyprotein Processing

The LGTV polyprotein is processed in the endoplasmic reticulum (ER) through a combination of cellular signalases and the viral NS2B-NS3 serine protease. Key steps include:

  • Structural protein cleavage: The N-terminal region yields C, prM, and E proteins. prM undergoes furin-mediated maturation in the Golgi to produce mature M protein .

  • Non-structural protein processing: NS3 acts as a helicase/protease, while NS5 functions as the RNA-dependent RNA polymerase (RdRp). Host proteins like SEC61 and TMEM41B assist in ER membrane remodeling for replication compartments .

Chimeric Constructs and Functional Insights

Recombinant LGTV polyproteins have been central to studies on vector specificity and pathogenesis. Notable findings include:

Table 1: Chimeric LGTV Constructs and Outcomes

Construct DescriptionKey FindingsSource
LGTV 5′/3′ UTR replaced with dengue virusNon-viable in Vero/BHK-21 cells due to incompatibility with DENV coding region
LGTV prM-E replaced with TBEVAltered virion maturation efficiency (46% mature vs. 2.5% in controls)
LGTV NS3-K46E mutationReduced neuroinvasiveness in SCID mice

These studies highlight the role of UTRs and structural proteins in host adaptation. For example, chimeras with tick-borne virus UTRs failed to replicate in mosquito cells, implicating UTR secondary structures in vector specificity .

Host Interactions and Immune Evasion

The LGTV polyprotein interacts with host pathways to facilitate replication:

  • ER stress response: LGTV activates the PERK-mediated unfolded protein response (UPR), but PERK-deficient cells show 8-fold higher viral titers, indicating PERK’s antiviral role .

  • Membrane remodeling: NS4A/B recruit host factors like RTN3.1A and TMEM41B to induce ER membrane curvature for replication organelles .

Table 2: Impact of prM Furin Cleavage Site Mutations

Mutation (Residue 86)% Mature VirionsPhenotype
Arginine (R86)46%Enhanced virion maturation
Glutamine (Q86)2.5%Predominantly immature particles

This residue governs furin cleavage efficiency, affecting virion infectivity .

Applications in Vaccine Development

Attenuated LGTV strains with polyprotein mutations serve as vaccine candidates:

  • E5-104 mutant: Contains NS3-K46E and E-K315E substitutions, reducing neuroinvasiveness in mice by >1,000-fold .

  • Chimeric LGTV/TBEV: Retains antigenic cross-reactivity with tick-borne encephalitis serocomplex viruses while showing reduced pathogenicity .

Key Challenges and Future Directions

  • Genetic stability: Insertion of foreign sequences (e.g., reporter tags) requires precise placement to avoid disrupting polyprotein function .

  • Host adaptation: Mechanisms underlying UTR-protein interactions remain poorly resolved, necessitating deeper structural studies .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Genome polyprotein; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
281-776
Protein Length
full length protein
Species
Langat virus (strain Yelantsev)
Target Protein Sequence
SRCTHLENRDFVTGVQGTTRLTLVLELGGCVTVTADGKPSLDVWLDSIYQESPAQTREYC LHAKLTGTKVAARCPTMGPATLPEEHQSGTVCKRDQSDRGWGNHCGLFGKGSIVTCVKFT CEDKKKATGHVYDVNKITYTIKVEPHTGEFVAANETHSGRKSASFTVSSEKTILTLGDYG DVSLLCRVASGVDLAQTVVLALDKTHEHLPTAWQVHRDWFNDLALPWKHDGAEAWNEAGR LVEFGTPHAVKMDVFNLGDQTGVLLKSLAGVPVASIEGTKYHLKSGHVTCEVGLEKLKMK GLTYTVCDKTKFTWKRAPTDSGHDTVVMEVGFSGTRPCRIPVRAVAHGVPEVNVAMLITP NPTMENNGGGFIEMQLPPGDNIIYVGDLNHQWFQKGSSIGRVLQKTRKGIERLTVLGEHA WDFGSVGGVMTSIGRAMHTVLGGAFNTLLGGVGFLPKILLGVAMAWLGLNMRNPTLSMGF LLSGGLVLAMTLGVGA
Uniprot No.

Target Background

Function

The capsid protein C self-assembles into an icosahedral capsid approximately 30 nm in diameter, encapsulating the genomic RNA. prM acts as a chaperone for the envelope protein E during intracellular virion assembly, masking and inactivating the E protein fusion peptide. prM maturation occurs in the final stage of virion assembly, likely preventing premature activation of the fusion peptide due to the acidic pH of the trans-Golgi network. Following cleavage by host furin, the pr peptide is released extracellularly, and the dissociation of the envelope protein M and envelope protein E homodimers occurs. Envelope protein E binding to the host cell surface receptor triggers virus internalization via clathrin-mediated endocytosis. Subsequently, envelope protein E mediates membrane fusion between the virion and host late endosomes. It is synthesized as a homodimer with prM, which serves as a chaperone. After prM cleavage, envelope protein E dissociates from envelope protein M and homodimerizes.

Subcellular Location
[Capsid protein C]: Virion.; [Peptide pr]: Secreted.; [Small envelope protein M]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein.; [Envelope protein E]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the Langat virus and its genome polyprotein?

Langat virus (LGTV) is a member of the tick-borne encephalitis virus (TBEV) complex within the genus Flavivirus of the family Flaviviridae. It was initially isolated from Ixodes granulatus ticks in Malaysia . LGTV is a lipid-enveloped virus carrying a positive-sense single-stranded RNA genome of approximately 11 kb in length. This genome encodes a polyprotein that shares approximately 84% amino acid homology with some strains of TBEV . The polyprotein undergoes co- and post-translational processing by host and viral proteases to produce three structural proteins (capsid, precursor membrane, and envelope) and seven non-structural proteins (NS1, NS2A, NS2B, NS3, NS4A, NS4B, and NS5) .

What are the functional roles of the Langat virus genome polyprotein?

The Langat virus genome polyprotein plays multiple critical roles in the viral life cycle:

  • It facilitates virus budding by binding to membranes and packaging viral RNA into nucleocapsids that form the core of mature virus particles .

  • During virus entry, it may assist in genome penetration into the host cytoplasm following hemifusion induced by surface proteins .

  • It can translocate to the cell nucleus to modulate host functions .

  • It inhibits RNA silencing by interfering with the host Dicer enzyme .

  • Through its precursor membrane (prM) component, it prevents premature fusion of envelope proteins in the trans-Golgi network by binding to envelope protein E at pH 6.0 .

  • It acts as a chaperone for the envelope protein during intracellular virion assembly by masking the fusion peptide .

  • The inefficient cleavage of prM-E likely contributes to immune evasion strategies .

How does the M protein of Langat virus compare structurally to its precursor (prM)?

The M protein of Langat virus shows significant structural homology to its precursor form (prM). Studies using antiserum raised against the LGT virus M protein have demonstrated that this antiserum recognizes intracellular LGT virus prM/M and binds to both prM in whole-cell lysates and M in purified virus preparations when analyzed by Western blotting . This cross-reactivity suggests that prM and M proteins maintain similar structural characteristics under native conditions. Furthermore, research supports the hypothesis that the "pr" portion of prM plays a crucial role in facilitating the proper folding of the M protein, which is necessary for its correct expression on the virion surface . This structural relationship is functionally important for viral assembly and maturation processes.

What techniques are available for the detection and quantification of Langat virus?

A highly sensitive and specific real-time quantitative reverse-transcription-polymerase chain reaction (qRT-PCR) has been developed for detecting Langat virus. This TaqMan-based assay can detect LGTV at titers as low as 0.1 FFU/ml with a detection limit at 95% probability of 0.28 FFU/ml as determined by probit analysis (p ≤ 0.05) . The developed primers and probe demonstrate excellent specificity, as they do not amplify the ORF of the E genes from related and more pathogenic viruses, including TBEV, Louping ill virus, Omsk hemorrhagic fever virus, Alkhurma virus, Kyasanur Forest Disease virus, and Powassan virus .

For experimental validation, the sensitivity of this method has been confirmed by:

  • Testing with LGTV-infected tick cell lines

  • Analysis of LGTV-spiked tick tissues

  • Comparative analysis with other detection methods

This qRT-PCR approach offers significant advantages for surveillance studies, experimental research, and diagnostic applications when working with Langat virus and its recombinant proteins.

How can neutralization assays be performed to assess antibody responses against Langat virus?

Neutralization assays for evaluating antibody responses against Langat virus typically employ plaque reduction neutralization tests (PRNT). This methodology allows researchers to determine the effectiveness of antibodies in neutralizing viral infection. Based on the research data, the following protocol can be implemented:

  • Prepare serial dilutions of test sera.

  • Mix each dilution with a standardized quantity of Langat virus (typically 100 PFU).

  • Incubate the virus-serum mixtures to allow antibody binding.

  • Apply the mixtures to susceptible cell monolayers.

  • Overlay with semi-solid medium to restrict viral spread.

  • Incubate cells to allow plaque formation.

  • Fix and stain cell monolayers to visualize plaques.

  • Calculate the serum dilution that reduces plaque formation by 80% compared to controls.

Research data indicates that antisera raised against LGT virus M protein can achieve PRNT titers of approximately 80 against homologous LGT TP21 strain and 160 against the related Powassan virus strain L8, while showing no significant neutralization (titers <20) against more distantly related flaviviruses such as Dengue-4, Japanese encephalitis, or Yellow fever viruses . This protocol provides a quantitative measure of neutralizing antibody responses and can be used to assess cross-reactivity between different flaviviruses.

Virus strainPRNT titerHI titer with virusHI titer with viral antigen
LGT TP218010<10
POW L8160<10<10
DEN-4 1007<20ND<10
JE P3<20ND10
YF 17D<20ND10

Note: PRNT titers reflect an 80% plaque reduction in a 100-PFU test; ND = not determined .

What experimental approaches can be used to study the role of prM-E cleavage in Langat virus pathogenesis?

Investigating the role of prM-E cleavage in Langat virus pathogenesis requires multiple experimental approaches:

  • Site-directed mutagenesis of cleavage sites:

    • Generate recombinant Langat viruses with mutations at the furin cleavage site between prM and E proteins

    • Create variants with enhanced or reduced cleavage efficiency

    • Analyze the resulting viruses for changes in assembly, maturation, and infectivity

  • Cellular cleavage inhibition studies:

    • Treat infected cells with furin inhibitors during virus production

    • Quantify the proportion of mature versus immature particles using Western blot analysis

    • Assess the impact on virus infectivity and immune recognition

  • Structural analysis of partially mature virions:

    • Purify virus particles with different degrees of prM-E cleavage

    • Employ cryo-electron microscopy to visualize structural differences

    • Correlate structural features with functional properties

  • Immunological recognition experiments:

    • Test neutralizing capacity of antibodies against fully mature versus partially mature virions

    • Analyze epitope accessibility on virions with different maturation states

    • Evaluate the hypothesis that uncleaved prM contributes to immune evasion

These approaches can provide insights into how inefficient prM-E cleavage, which is a noted characteristic of tick-borne flaviviruses including Langat virus, contributes to pathogenesis and immune evasion strategies.

How does Langat virus genome polyprotein compare with other flavivirus polyproteins?

The Langat virus genome polyprotein shares significant homology with other flavivirus polyproteins, particularly those in the tick-borne encephalitis virus complex. Comparative analysis reveals:

  • Sequence homology: The LGTV polyprotein shares approximately 84% amino acid homology with certain TBEV strains , making it a valuable model system for studying the more pathogenic TBEV.

  • Structural protein similarities: The M protein of Langat virus demonstrates immunological cross-reactivity with other tick-borne encephalitis serocomplex flaviviruses but not with mosquito-borne flaviviruses. This is evidenced by neutralization studies showing that antisera raised against LGTV M protein can neutralize tick-borne flaviviruses like Powassan virus (PRNT titer of 160) but not mosquito-borne flaviviruses such as Dengue-4, Japanese encephalitis, or Yellow fever viruses (PRNT titers <20) .

  • Functional conservation: The roles of polyprotein components in virus budding, RNA silencing inhibition, and preventing premature fusion activity appear to be conserved across the flavivirus genus, though with varying efficiencies that may contribute to differences in pathogenicity .

  • Maturation differences: Similar to other flaviviruses, Langat virus prM is processed by host furin in the trans-Golgi network, but the efficiency of this cleavage varies among flavivirus species, potentially contributing to differences in virulence and immune evasion capabilities .

This comparative approach provides insights into the structural and functional evolution of flaviviruses and may inform the development of broad-spectrum antivirals or vaccines.

How can Langat virus be used as a model system for studying more pathogenic tick-borne flaviviruses?

Langat virus serves as an excellent model system for studying more pathogenic tick-borne flaviviruses due to its reduced pathogenicity in humans while maintaining high genetic and functional similarity to virulent tick-borne encephalitis viruses. Researchers can leverage this model through several approaches:

  • Reverse genetic systems:

    • Generate recombinant Langat viruses containing specific sequences or mutations from pathogenic flaviviruses

    • Identify virulence determinants through chimeric virus construction

    • Test attenuation strategies in a safer experimental environment

  • Comparative immunology:

    • Study cross-neutralization between Langat virus and other tick-borne flaviviruses

    • Identify conserved epitopes for broad-spectrum vaccine development

    • Evaluate the basis for differential immune recognition

  • Diagnostic development:

    • Use Langat virus antigens as surrogate markers for detecting antibodies against more pathogenic flaviviruses

    • Develop and validate diagnostic tests using Langat virus before applying them to higher-risk pathogens

    • The specificity of such approaches is supported by studies showing that LGTV-specific primers and probes do not amplify sequences from related flaviviruses

  • Vaccine platform:

    • Explore Langat virus as a potential live-attenuated vaccine platform for tick-borne encephalitis viruses

    • Investigate the protective capacity of immune responses generated against the Langat virus genome polyprotein

    • Assess the duration and breadth of protection against challenge with heterologous viruses

This model system approach has been validated by studies demonstrating that antiserum against Langat virus M protein can neutralize other tick-borne encephalitis serocomplex flaviviruses, supporting the potential for cross-protective immunity .

What approaches can be used to engineer recombinant Langat virus polyproteins for vaccine development?

Engineering recombinant Langat virus polyproteins for vaccine development involves several strategic approaches:

  • Targeted mutation of specific domains:

    • Modify the fusion peptide of the E protein to reduce pathogenicity while maintaining immunogenicity

    • Introduce mutations in non-structural proteins to attenuate viral replication

    • These modifications can be achieved through site-directed mutagenesis of infectious cDNA clones

  • Chimeric polyprotein construction:

    • Replace specific antigenic domains of the Langat virus polyprotein with corresponding regions from more pathogenic flaviviruses

    • Create chimeras containing structural proteins from TBEV while maintaining the non-structural backbone of Langat virus

    • This approach leverages the safety profile of Langat virus while inducing immunity against priority pathogens

  • Expression systems for subunit vaccines:

    • Express selected immunogenic portions of the polyprotein (particularly E protein domains) in prokaryotic or eukaryotic expression systems

    • Optimize codon usage for the expression system while maintaining critical epitopes

    • Purify recombinant proteins using affinity chromatography for vaccine formulation

  • VLP production strategies:

    • Co-express the structural proteins (C, prM, and E) to generate virus-like particles

    • Modify the prM furin cleavage site to ensure optimal maturation

    • This approach mimics the structure of native virions without infectious genetic material

  • Adjuvant formulation:

    • Combine recombinant proteins with appropriate adjuvants to enhance immunogenicity

    • Test multiple adjuvant formulations for optimal humoral and cellular immune responses

    • Evaluate the durability of protective immunity using neutralization assays

Each of these approaches must be followed by rigorous immunogenicity and safety testing to determine the most promising vaccine candidates for further development.

What are the current challenges in expressing and purifying functional recombinant Langat virus polyprotein components?

Researchers face several significant challenges when expressing and purifying functional components of the Langat virus polyprotein:

  • Protein folding and conformation:

    • Maintaining native protein conformation during expression is difficult, especially for the envelope proteins that require specific disulfide bonding patterns

    • The structural proteins often depend on co-expression of multiple components for proper folding

    • Evidence from studies on the M protein suggests that the "pr" portion of prM is critical for proper folding of the M protein for correct surface expression

  • Expression system limitations:

    • Mammalian expression systems may provide proper post-translational modifications but yield lower protein quantities

    • Bacterial systems offer higher yields but lack glycosylation capabilities critical for proper folding and immunogenicity

    • Insect cell systems represent a compromise but may produce proteins with different glycosylation patterns than mammalian cells

  • Protein toxicity:

    • Some viral proteins, particularly those with membrane-modifying properties like M protein, may exhibit toxicity to host cells when overexpressed

    • The M protein has been shown to exert cytotoxic effects by activating mitochondrial apoptotic pathways through its ectodomain

  • Purification challenges:

    • Membrane-associated proteins require detergents for solubilization, which can affect protein structure and function

    • Maintaining protein-protein interactions during purification is difficult but may be essential for preserving functional epitopes

    • Separating correctly folded proteins from misfolded variants requires optimization of purification strategies

  • Stability issues:

    • Purified viral proteins often show limited stability in solution

    • Storage conditions and buffer compositions require careful optimization

    • Freeze-thaw cycles can significantly reduce protein activity and conformational integrity

Addressing these challenges requires iterative optimization of expression constructs, host systems, and purification protocols specific to each polyprotein component.

How can researchers address the data discrepancies observed in Langat virus polyprotein studies?

Researchers working with Langat virus polyprotein may encounter data discrepancies across different studies. These can be systematically addressed through several methodological approaches:

  • Standardization of experimental systems:

    • Establish consensus viral strains and cell lines for comparative studies

    • Implement standardized protocols for virus propagation and quantification

    • Develop reference materials for calibration across laboratories

    • This standardization is particularly important given that studies on viral proteins like the M protein use different expression systems and analytical techniques

  • Cross-validation with multiple techniques:

    • Verify findings using orthogonal methods (e.g., combining Western blotting with immunofluorescence and functional assays)

    • Use both in vitro and in vivo systems when possible to confirm biological relevance

    • Apply both binding assays and functional assays to correlate structure with function

  • Comprehensive reporting of experimental conditions:

    • Document detailed methods including passage history of virus stocks

    • Report complete expression construct sequences and purification protocols

    • Provide raw data along with processed results to enable reanalysis

  • Statistical rigor and reproducibility:

    • Perform adequate biological and technical replicates

    • Apply appropriate statistical tests with justification

    • Calculate effect sizes and confidence intervals rather than relying solely on p-values

  • Collaborative validation studies:

    • Conduct multi-laboratory studies using identical materials and protocols

    • Develop consensus assays for critical measurements like neutralization titers

    • Establish repositories of well-characterized reagents and reference materials

By implementing these approaches, researchers can better reconcile discrepancies in the literature and build a more coherent understanding of Langat virus polyprotein structure, function, and immunological properties.

How might structural biology approaches advance our understanding of Langat virus polyprotein processing and function?

Advanced structural biology techniques offer promising avenues for elucidating the molecular details of Langat virus polyprotein processing and function:

  • Cryo-electron microscopy (cryo-EM):

    • Determine high-resolution structures of the entire virion at different maturation stages

    • Visualize the arrangement of E and M proteins on the virus surface

    • Capture structural intermediates during the prM to M transition

    • These approaches could extend current understanding of how prM and M proteins maintain structural similarity under native conditions, as suggested by immunological studies

  • X-ray crystallography:

    • Resolve atomic-level structures of individual polyprotein components

    • Analyze protein-protein interfaces between structural proteins

    • Study complexes between viral proteins and host factors

    • Identify potential drug binding sites for antiviral development

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Characterize dynamic regions of viral proteins that may be disordered

    • Study protein-membrane interactions critical for viral assembly

    • Investigate conformational changes triggered by pH shifts during viral entry

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Map protein dynamics and conformational changes during virus maturation

    • Identify regions involved in protein-protein interactions

    • Study the accessibility of epitopes recognized by neutralizing antibodies

  • Single-molecule techniques:

    • Track polyprotein processing events in real-time

    • Measure forces involved in conformational changes during viral fusion

    • Analyze the kinetics of assembly and disassembly processes

These structural approaches, combined with functional assays, can provide unprecedented insights into the mechanisms of Langat virus polyprotein processing, virion assembly, and host cell entry, potentially revealing new targets for therapeutic intervention.

What potential applications exist for engineered Langat virus polyproteins beyond vaccine development?

Beyond vaccine applications, engineered Langat virus polyproteins offer diverse research and therapeutic potential:

  • Diagnostic platform development:

    • Engineered polyprotein fragments could serve as antigens in serological assays

    • Recombinant proteins can be used to develop monoclonal antibodies for diagnostic applications

    • Modified polyproteins could enable differential diagnosis between related flavivirus infections

    • This approach has precedent in the development of ELISAs based on recombinant proteins for detecting antibodies to TBEV and other flaviviruses

  • Drug discovery tools:

    • Express polyprotein-derived enzymes (like NS3 protease or NS5 polymerase) for high-throughput inhibitor screening

    • Develop cell-based assays using fluorescently tagged polyprotein components to visualize inhibition of viral processes

    • Create biosensors based on viral protein conformational changes for drug efficacy testing

  • Gene therapy and targeted delivery vehicles:

    • Utilize the cell entry mechanisms of viral envelope proteins for targeted delivery of therapeutic cargo

    • Develop pseudo-typed viral particles incorporating Langat virus envelope proteins for cell-specific targeting

    • Engineer extracellular vesicles displaying viral antigens for immunomodulation

  • Research tools for fundamental virology:

    • Generate reporter viruses with fluorescent or luminescent tags inserted into the polyprotein

    • Create temperature-sensitive mutants for studying specific stages of the viral life cycle

    • Develop tools for visualizing viral RNA-protein interactions during replication

  • Protein engineering platforms:

    • Use the structural scaffolds of viral proteins for designing novel protein functions

    • Study protein-protein interfaces for insights into protein engineering principles

    • Explore the application of viral protein assembly mechanisms for nanotechnology applications

These diverse applications leverage the structural and functional properties of Langat virus polyproteins while benefiting from the relative safety of working with this less pathogenic member of the tick-borne encephalitis virus complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.