Recombinant Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
mscL; Z4661; ECs4156; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
mscL
Target Protein Sequence
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEV LLTEIRDLLKEQNNRS
Uniprot No.

Target Background

Function

A mechanosensitive ion channel that opens in response to membrane stretch. It may play a role in regulating cellular osmotic pressure.

Database Links

KEGG: ece:Z4661

STRING: 155864.Z4661

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the physiological role of MscL in bacteria?

MscL (mechanosensitive channel of large conductance) functions as an emergency release valve in bacterial cells, primarily responding to osmotic downshock. When bacteria experience a sudden decrease in external osmolarity, MscL channels open to rapidly discharge cytoplasmic solutes, preventing cell lysis. This emergency response mechanism allows the channel to pass molecules up to 30 Å in diameter, creating the largest known gated pore in biological systems . Physiological studies demonstrate that MscL activation serves as a last-ditch protective mechanism when bacterial cells face extreme osmotic stress that threatens membrane integrity.

How does MscL sense mechanical force in the membrane?

MscL directly senses biophysical changes in the membrane without requiring intermediate signaling molecules. The channel responds to membrane tension through a mechanism where lateral forces in the lipid bilayer are directly transmitted to the channel protein, causing conformational changes that lead to pore opening . This direct mechanosensation occurs because MscL is embedded in the lipid bilayer where it can detect changes in membrane thickness and lateral pressure profiles. When membrane tension increases, the protein undergoes extensive conformational changes involving specific transmembrane segments that ultimately result in channel opening.

What structural elements are critical for MscL function?

Several key structural elements are essential for proper MscL function:

  • The "slide helix" or series of charges at the cytoplasmic membrane boundary that guides transmembrane movements during gating

  • Important subunit interfaces that, when disrupted, cause the channel to gate inappropriately

  • The N-h-h-D motif (where "h" represents hydrophobic amino acids), which plays critical functional roles in many channels including MscL

What are the best experimental designs to study MscL function in vitro?

Effective experimental designs for studying MscL function in vitro should include:

  • Reconstitution in artificial lipid bilayers: Purified MscL protein should be reconstituted in liposomes or planar lipid bilayers with controlled lipid composition. This allows for precise control of membrane properties that influence channel gating.

  • Patch-clamp electrophysiology: This technique remains the gold standard for studying channel activity, providing direct measurement of channel opening and conductance under controlled membrane tension.

  • Fluorescence-based assays: Using fluorescent dyes to monitor solute release from liposomes containing MscL channels when subjected to osmotic stress or membrane stretching.

  • Controls for verification: Include parallel experiments with MscL mutants with known gating properties as positive and negative controls to validate experimental setup .

The experimental design should carefully control for variables that affect MscL function, including lipid composition, temperature, pH, and ionic strength. A well-designed experiment will isolate the effect of the independent variable (e.g., membrane tension) on the dependent variable (channel opening) while minimizing confounding factors .

How can researchers avoid common errors in MscL functional studies?

Several methodological precautions can help researchers avoid common errors in MscL studies:

Researchers should also avoid extrapolation errors, where findings from acute, short-term experiments are inappropriately extended to predict chronic effects or broader biological significance .

What expression systems are most effective for recombinant MscL production?

The effectiveness of expression systems for recombinant MscL production varies depending on research objectives:

E. coli-based systems:

Alternative systems:

  • Cell-free protein synthesis systems can be advantageous for difficult membrane proteins like MscL, allowing direct incorporation into artificial liposomes

  • Yeast expression systems may provide better folding environments for specific MscL variants or fusion constructs

How does translation stress affect recombinant MscL function and localization?

Translation stress positively regulates MscL-dependent excretion of proteins in bacterial systems. Both protein overexpression in recombinant cells and antibiotic-induced translation stress in wild-type E. coli lead to increased MscL-dependent protein excretion .

Key findings regarding translation stress and MscL function include:

  • When chloramphenicol (Cm) was added to cultures expressing recombinant eGFP, extracellular localization of eGFP continued even though cell growth stopped. This indicates that the source of extracellularly localized recombinant protein is an existing pool of already translated protein rather than resulting from cell lysis .

  • In MscL knockout strains (ΔmscL), periplasmic localization of recombinant proteins decreased significantly (14-fold reduction, P = 1.3 × 10^-3), demonstrating MscL's direct role in protein excretion to the periplasm .

  • Episomal expression of MscL in knockout strains rescued the periplasmic localization phenotype, confirming MscL's specific involvement in this process .

These findings suggest that translation stress may trigger conformational changes in MscL that facilitate protein excretion, potentially through alterations in membrane properties or direct interactions with the channel.

How can MscL be engineered as a nanovalve for drug delivery applications?

MscL can be engineered as a controllable nanovalve through several sophisticated strategies:

  • Site-directed mutagenesis: Introducing specific mutations at the channel constriction site can alter gating sensitivity and selectivity. For example, replacing hydrophobic residues with charged amino acids can create MscL variants that respond to specific stimuli beyond mechanical force.

  • Light-activated MscL variants: Incorporating light-sensitive moieties (e.g., azobenzene derivatives) at strategic locations allows for remote control of channel opening using specific wavelengths of light.

  • pH-responsive modifications: Engineering pH-sensitive domains into MscL creates channels that open in response to pH changes, potentially useful for targeting acidic environments like tumors.

  • Ligand-gated MscL chimeras: Fusion of ligand-binding domains can create chimeric channels that open in response to specific molecules, enabling targeted release of encapsulated compounds.

For drug delivery applications, recombinant MscL can be reconstituted into liposomes containing therapeutic compounds. These engineered liposomes must be thoroughly characterized for stability, controlled release kinetics, and biocompatibility before moving toward translational applications .

What role does MscL play in antibiotic uptake and bacterial resistance mechanisms?

MscL plays a significant role in antibiotic uptake and potentially in resistance mechanisms:

  • Antibiotic entry pathway: The antibiotic streptomycin has been shown to open MscL channels and use them as one of the primary paths to enter the bacterial cytoplasm . This finding suggests MscL may be an important entry route for certain antibiotics.

  • Potential resistance mechanism: Mutations affecting MscL expression or function could potentially contribute to antibiotic resistance by limiting drug entry. Conversely, compounds that specifically activate MscL could potentially enhance antibiotic uptake and efficacy.

  • Stress response connection: Since translation stress positively regulates MscL-dependent excretion , there may be complex relationships between antibiotic-induced stress responses and MscL activity that affect cellular responses to antibiotics.

This area represents an emerging field of research with potential implications for developing novel antibacterial strategies, including MscL-targeting compounds that could function as antibiotic adjuvants by enhancing drug uptake or preventing resistance development.

What are common pitfalls in MscL purification and how can they be avoided?

Common pitfalls in MscL purification and their solutions include:

PitfallManifestationSolution
Protein aggregationPrecipitation during purification; high molecular weight bands on SECUse milder detergents (DDM, LMNG); add glycerol (5-10%); purify at 4°C
Low expression yieldsMinimal band on SDS-PAGEOptimize codon usage; lower induction temperature; use C41/C43 E. coli strains specialized for membrane proteins
Loss of functionPurified protein shows no channel activityAvoid harsh detergents; minimize exposure to high temperatures; verify proper refolding after purification
ImpuritiesMultiple bands on SDS-PAGEInclude additional purification steps; optimize imidazole concentration in washing buffers for His-tagged constructs
Detergent interferenceInconsistent functional assaysCarefully control detergent concentration; consider detergent exchange during purification

Researchers should systematically optimize each purification step, maintaining careful records of all conditions and their effects on protein yield and activity. Performing small-scale test purifications before scaling up can save considerable time and resources while identifying optimal conditions .

How can researchers resolve contradictory data in MscL functional studies?

When faced with contradictory data in MscL functional studies, researchers should take a systematic approach:

When reporting resolutions to contradictory data, avoid extrapolation errors and clearly delineate what the evidence directly supports versus what remains speculative .

What are the current models explaining the conformational changes during MscL gating?

Current models of MscL gating describe a complex sequence of conformational changes:

  • Iris-like expansion model: The transmembrane helices rotate and tilt away from the central axis like an iris diaphragm during channel opening. This model is supported by crystallographic data and molecular dynamics simulations.

  • Tension-sensing mechanism: Membrane tension is sensed by the interaction between the channel's transmembrane domains and the lipid bilayer. As membrane tension increases, the energetic cost of maintaining the closed state exceeds that of opening.

  • Two-stage gating process: Recent evidence suggests MscL undergoes a two-stage opening with an intermediate conformation before reaching the fully open state. This intermediate state may play physiological roles in moderate osmotic stress responses.

The gating process involves critical structural elements including the "slide helix" at the cytoplasmic membrane boundary that guides transmembrane movements during gating . Disruption of important subunit interfaces can cause the channel to gate inappropriately, highlighting their role in stabilizing the closed conformation.

Evolutionary analysis shows that channels and sensors share common gene ancestors, explaining why MscL contains structural and functional themes that recur in channels across different organisms and can serve as a paradigm for understanding other channel types .

How do mutations in the N-h-h-D motif affect MscL function and gating properties?

The N-h-h-D motif (where "h" represents hydrophobic amino acids) is a consensus sequence found in many channel families including MscL. Mutations in this motif produce specific effects on channel function:

  • Changes in gating threshold: Mutations that modify the hydrophobicity of the "h" positions often alter the tension required to open the channel. Decreasing hydrophobicity typically reduces the gating threshold, creating channels that open more easily.

  • Altered ion selectivity: While MscL is generally non-selective, specific mutations in the N-h-h-D motif can introduce slight preferences for certain ions by altering the electrostatic environment of the pore.

  • Gating kinetics effects: Mutations in this region can affect how quickly the channel opens and closes in response to tension, potentially by altering the energy barriers between conformational states.

  • Stability impacts: Some mutations destabilize the protein structure, resulting in lower expression levels or increased protein degradation during purification.

The N-h-h-D motif appears to play important functional roles in many channels, including MscL, highlighting its evolutionary significance in channel structure and function . Experimental studies systematically mutating each position in this motif have provided valuable insights into structure-function relationships in mechanosensitive channels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.