Recombinant Laribacter hongkongensis Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; LHK_03216; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Laribacter hongkongensis (strain HLHK9)
Target Names
cobS
Target Protein Sequence
MRSLILAVQFLTRLPTPQLRTFDPAWLAGAIRWFAVVGLLVGALVAALGWLGAWLDPWLA ALLMLVTWVWVTGGLHLDGLGDLADGLGAAHRSPERFLAVLKDPHTGSFAVITLALQLLA KLVLLMLAVRHGVGWSALVLLPAWARLGAVWWTTLPPLSAGGHAERFAWRHDWPAFWLSW LLLAALSAWLAPVLLLAPVLWWGWRRFLWRRLGGMSGDCLGAGIELTETGLLLLAVVATR LPLA
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from Laribacter hongkongensis catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by combining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the cobS gene in Laribacter hongkongensis?

The cobS gene in L. hongkongensis is part of the cobalamin biosynthetic operon, which includes several other genes involved in vitamin B12 production. While specific genomic data on cobS is limited in the literature, researchers should note that L. hongkongensis contains various metabolic pathways that may interact with cobalamin synthesis. The bacterium shows significant metabolic adaptability, particularly in carbon source utilization, with preference for malate over traditional sugar carbon sources . When investigating the cobS gene, researchers should consider its relationship to central metabolic pathways, as L. hongkongensis integrates information from different metabolic branches to coordinate gene expression in response to environmental changes .

What expression systems are most suitable for recombinant production of L. hongkongensis cobS?

Methodologically, researchers should:

  • Start with pET-based expression vectors with T7 promoter systems

  • Consider adding a cleavable His-tag for purification purposes

  • Test expression at lower temperatures (16-25°C) to improve protein solubility

  • Supplement growth media with cobalt ions, as cobS requires cobalt for functionality

Based on RNA extraction protocols used successfully with L. hongkongensis, apply similar careful handling techniques when working with recombinant proteins from this organism .

How should initial activity assays for recombinant L. hongkongensis cobS be designed?

Initial activity assays for recombinant L. hongkongensis cobS should incorporate methodological considerations specific to cobalamin synthases while accounting for L. hongkongensis's unique biochemistry. Design your activity assays following these guidelines:

  • Substrate preparation: Use hydrogenobyrinic acid a,c-diamide (HBAD) as substrate

  • Buffer optimization: Test multiple buffer systems (50 mM Tris-HCl, pH 7.5-8.0; 50 mM HEPES, pH 7.5)

  • Co-factor requirements: Include ATP (1-5 mM), MgCl₂ (5-10 mM), and reduced glutathione (1-5 mM)

  • Detection methods: Use HPLC analysis with UV detection at 367 nm to monitor cobalamin formation

When analyzing activity data, consider that L. hongkongensis has adaptable central metabolism, and cobS may be influenced by the sophisticated regulatory network that coordinates various metabolic pathways in this organism .

What strategies can overcome expression challenges for recombinant L. hongkongensis cobS?

When facing expression challenges with recombinant L. hongkongensis cobS, implement these advanced strategies:

  • Codon optimization: Analyze L. hongkongensis cobS gene codon usage and optimize for your expression host. L. hongkongensis exhibits distinct transcriptional regulatory patterns as observed in RNA-sequencing studies .

  • Fusion partners: Test multiple fusion partners to enhance solubility:

    • Thioredoxin (TrxA)

    • Glutathione S-transferase (GST)

    • Maltose-binding protein (MBP)

    • SUMO (Small Ubiquitin-like Modifier)

  • Chaperone co-expression: Co-express with molecular chaperones like GroEL/GroES or DnaK/DnaJ/GrpE.

  • Membrane extraction optimization: If cobS associates with membranes, optimize extraction using:

DetergentWorking ConcentrationNotes
DDM0.03-0.1%Mild, maintains enzyme activity
CHAPS0.5-1.0%Good for solubilization
Triton X-1000.1-0.5%Effective but can interfere with spectrophotometric assays
  • Induction conditions: Based on studies of other L. hongkongensis proteins, optimize expression by varying temperature (15-30°C) and IPTG concentration (0.1-1.0 mM) .

How can structural characterization of L. hongkongensis cobS inform functional studies?

Structural characterization of L. hongkongensis cobS provides critical insights for functional studies. Implement this stepwise approach:

  • Initial structural prediction:

    • Use homology modeling based on existing bacterial cobS structures

    • Analyze primary sequence for conserved domains and catalytic residues

  • Experimental structure determination:

    • X-ray crystallography: Optimize protein crystals using sitting-drop vapor diffusion with PEG 3350 (15-25%) and various salt conditions

    • Cryo-EM: Consider if protein forms higher-order complexes

  • Structure-guided functional analysis:

    • Identify active site residues for site-directed mutagenesis

    • Map surface electrostatics to predict protein-protein interactions

    • Analyze ATP-binding pocket to understand energy coupling

  • Comparative structural biology:

    • Compare with cobS from other bacteria to identify unique features

    • Map L. hongkongensis-specific insertions or deletions

When analyzing structural data, remember that L. hongkongensis demonstrates complex metabolic adaptation mechanisms, suggesting that cobS may have evolved specific regulatory features to function within this bacterium's unique metabolic network .

What transcriptional regulatory mechanisms might control cobS expression in L. hongkongensis?

Based on transcriptomic studies of L. hongkongensis, several regulatory mechanisms likely control cobS expression:

  • CRP (cAMP Receptor Protein) regulation: L. hongkongensis CRP has been identified as a transcription factor that responds to environmental stresses and influences various metabolic pathways . CRP may regulate cobS expression as part of the cobalamin biosynthetic pathway.

  • Malate-dependent regulation: Malate utilization significantly impacts central metabolism in L. hongkongensis, enhancing respiratory chain function and carbon metabolism . Design experiments to test if malate availability affects cobS expression using:

    • qRT-PCR to measure cobS mRNA levels with/without malate supplementation

    • Reporter gene assays (GFP fusion) to monitor cobS promoter activity under varying conditions

  • Environmental stress response: L. hongkongensis genes show differential expression under:

    • Anaerobic conditions

    • Acidic environments (pH 2.0-4.0)

    • Temperature variation (20°C vs. 37°C)

Methodological approach to studying cobS regulation:

  • Construct transcriptional fusions between cobS promoter and reporter genes (like GFP)

  • Measure promoter activity across different growth conditions

  • Perform ChIP-seq to identify transcription factors binding to the cobS promoter

  • Create knockout mutants of candidate regulators to assess their effect on cobS expression

What is the optimal purification strategy for obtaining high-quality L. hongkongensis cobS for enzymatic studies?

A multi-step purification strategy is recommended for isolating L. hongkongensis cobS at high purity while maintaining enzymatic activity:

  • Initial extraction: Based on protocols used for other L. hongkongensis proteins, harvest cells and disrupt using either:

    • Sonication (6 × 10s bursts on ice)

    • French press (1000 psi)
      in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT, and protease inhibitor cocktail

  • Multi-step chromatographic purification:

Purification StepBuffer CompositionElution Conditions
IMAC (Ni-NTA)50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol20-250 mM imidazole gradient
Tag removalAs above + TEV protease (1:50 ratio)Overnight at 4°C
Ion exchange20 mM Tris-HCl pH 7.5, 50 mM NaCl50-500 mM NaCl gradient
Size exclusion20 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerolIsocratic elution
  • Quality assessment:

    • SDS-PAGE: >95% purity

    • Dynamic light scattering: Monodispersity check

    • Circular dichroism: Secondary structure confirmation

    • Thermal shift assay: Stability assessment

  • Activity preservation: Add stabilizing agents (10% glycerol, 1 mM DTT) and store at -80°C in small aliquots to prevent freeze-thaw cycles.

How can researchers troubleshoot low enzyme activity in purified recombinant L. hongkongensis cobS?

When facing low enzymatic activity with purified recombinant L. hongkongensis cobS, systematically evaluate these factors:

  • Metal ion coordination:

    • CobS requires cobalt for activity; supplement reaction buffer with CoCl₂ (0.1-1.0 mM)

    • Test the effect of other divalent cations (Mg²⁺, Mn²⁺, Zn²⁺) on activity

  • Redox environment optimization:

    • CobS function is sensitive to oxidation

    • Test various reducing agents: DTT (1-5 mM), β-mercaptoethanol (5-10 mM), TCEP (0.5-2 mM)

    • Prepare and handle samples under anaerobic conditions when possible

  • Substrate quality assessment:

    • Verify substrate integrity by HPLC analysis

    • Prepare fresh substrate solutions before assays

  • Co-factor supplementation matrix:

Co-factorConcentration RangeEffect on Activity
ATP1-10 mMEssential for energy coupling
GTP1-5 mMMay enhance activity
SAM0.1-1 mMRequired for methylation steps
NADH/NADPH0.5-2 mMProvides reducing equivalents
  • Buffer system optimization:

    • Test pH range (7.0-8.5) in different buffer systems

    • Optimize ionic strength (50-300 mM NaCl or KCl)

    • Consider the effect of osmolytes (glycerol, trehalose) on protein stability

Remember that L. hongkongensis has unique metabolic characteristics, and its enzymes may have evolved specific requirements that differ from model organisms .

How should kinetic parameters of recombinant L. hongkongensis cobS be determined and interpreted?

Determining and interpreting kinetic parameters for recombinant L. hongkongensis cobS requires rigorous experimental design and careful analysis:

  • Steady-state kinetics determination:

    • Ensure linear reaction rates (<10% substrate conversion)

    • Measure initial velocities across a range of substrate concentrations (0.1-10× K<sub>m</sub>)

    • Perform reactions at physiologically relevant temperature (37°C)

    • Include appropriate controls (heat-inactivated enzyme, no substrate)

  • Data analysis approaches:

    • Use non-linear regression to fit data to Michaelis-Menten equation

    • Consider alternative models if data shows cooperativity (Hill equation) or substrate inhibition

    • Determine confidence intervals for all kinetic parameters

  • Comparative analysis with cobS from other bacteria:

ParameterL. hongkongensis cobSSimilar Bacterial cobSInterpretation
K<sub>m</sub> for HBADTo be determined1-50 μM (typical)Substrate affinity
k<sub>cat</sub>To be determined0.1-10 s<sup>-1</sup> (typical)Catalytic efficiency
K<sub>m</sub> for ATPTo be determined50-500 μM (typical)Energy coupling efficiency
pH optimumTo be determined7.5-8.5 (typical)Environmental adaptation
  • Physiological relevance:

    • Compare kinetic parameters to estimated cellular concentrations of substrates

    • Consider how L. hongkongensis's unique metabolism and environmental niche might influence cobS activity

What approaches can resolve discrepancies between in vitro and in vivo activities of L. hongkongensis cobS?

Resolving discrepancies between in vitro and in vivo activities of L. hongkongensis cobS requires integrative approaches that bridge biochemical and cellular analyses:

  • Cellular factors affecting activity:

    • Identify potential protein-protein interactions using pull-down assays or bacterial two-hybrid systems

    • Test if RNA or metabolites act as regulators using activity assays with cellular extracts

    • Examine post-translational modifications via mass spectrometry

  • Metabolic context reconstruction:

    • Create a cell-free extract system from L. hongkongensis to better mimic cellular conditions

    • Supplement in vitro reactions with L. hongkongensis metabolite extracts

    • Develop metabolomics approaches to monitor changes in cobalamin-related metabolites

  • Genetic approaches:

    • Generate cobS knockout mutants and assess phenotypic effects

    • Perform complementation studies with wild-type and mutant cobS variants

    • Use reporter systems to monitor cobalamin production in vivo

  • Environmental condition mimicry:

    • L. hongkongensis experiences various environmental conditions; test enzyme activity under:

      • Varying pH (pH 2.0-8.0)

      • Different oxygen tensions (aerobic vs. anaerobic)

      • Temperature changes (20°C vs. 37°C)

      • Different carbon sources (with/without malate)

  • Advanced in vitro reconstitution:

    • Reconstruct the complete cobalamin biosynthetic pathway in vitro

    • Test cobS activity in the presence of upstream and downstream enzymes

    • Monitor metabolic flux through the pathway using isotope-labeled precursors

How can structural insights from L. hongkongensis cobS contribute to antimicrobial drug discovery?

Structural insights from L. hongkongensis cobS can significantly impact antimicrobial drug discovery through these methodological approaches:

  • Selective inhibitor design:

    • Identify unique structural features in L. hongkongensis cobS compared to human enzymes

    • Focus on the ATP-binding pocket and substrate recognition sites

    • Develop high-throughput screening assays to identify inhibitors that selectively target bacterial cobS

  • Structure-based drug design workflow:

    • Generate a high-resolution crystal structure of L. hongkongensis cobS

    • Perform computational docking of virtual compound libraries

    • Identify lead compounds that bind to critical catalytic residues

    • Optimize lead compounds through medicinal chemistry approaches

  • Biological validation strategy:

    • Test inhibitor efficacy against recombinant cobS in vitro

    • Evaluate antimicrobial activity against L. hongkongensis cultures

    • Assess effects on cobalamin biosynthesis pathway using metabolomics

    • Determine inhibitor specificity against cobS from other pathogenic bacteria

  • Resistance mechanism prediction:

    • Identify potential resistance mutations through structural analysis

    • Test the effects of these mutations on inhibitor binding

    • Develop combination approaches to mitigate resistance development

Remember that L. hongkongensis has unique metabolic adaptations, including malate utilization and response to environmental stress, which should be considered when developing antimicrobial strategies targeting its cobalamin biosynthesis pathway .

What methodological approaches can elucidate the role of cobS in L. hongkongensis pathogenesis?

To investigate the role of cobS in L. hongkongensis pathogenesis, implement these methodological approaches:

  • Gene knockout and complementation studies:

    • Generate cobS deletion mutants using homologous recombination techniques

    • Create complementation strains with wild-type and catalytically inactive cobS variants

    • Assess virulence in appropriate infection models

  • Transcriptomic analysis:

    • Compare gene expression profiles between wild-type and cobS mutant strains

    • Identify pathways affected by cobS deletion

    • Focus on virulence factor expression changes

    • Apply RNA extraction and RNA-seq methods previously optimized for L. hongkongensis

  • Host-pathogen interaction studies:

    • Evaluate adhesion to and invasion of epithelial cells

    • Measure intracellular survival in macrophages

    • Assess biofilm formation capacity

  • Metabolomic profiling:

    • Compare cobalamin-dependent metabolites between wild-type and cobS mutant

    • Identify metabolic bottlenecks that may contribute to attenuated virulence

    • Analyze changes in central carbon metabolism, which is known to be important for L. hongkongensis adaptation

  • In vivo competition assays:

    • Co-infect with wild-type and cobS mutant strains

    • Calculate competitive index in different host tissues

    • Identify host niches where cobalamin biosynthesis is critical

When interpreting results, consider that L. hongkongensis adaptation mechanisms, including respiratory chain function and central carbon metabolism, may be interconnected with cobalamin biosynthesis and consequently influence pathogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.