Recombinant Laribacter hongkongensis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; LHK_00623; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Laribacter hongkongensis (strain HLHK9)
Target Names
plsY
Target Protein Sequence
MTTIASLVLAYLLGSVPFAVLVSLGMGLADPRSYGSGNPGATNVLRSGNKLAALLTLLGD AAKGWLAVWLAQTYGASFGLAAPEIAMVGLAVFIGHLWPVFLAFRGGKGVATALGVLLAV NPWLALIAAAVWLAVALLTRYSSLAAMVSAVATAVAAWFIEPGVYAGLTIVIALLLVRRH KQNILNLVSGTESRIGGKKKS
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Glycerol-3-phosphate acyltransferase (plsY) in Laribacter hongkongensis?

Glycerol-3-phosphate acyltransferase (plsY) in Laribacter hongkongensis catalyzes the first and rate-limiting step in the de novo pathway of glycerolipid synthesis. Specifically, it transfers an acyl group from acyl-CoA to glycerol-3-phosphate, forming lysophosphatidic acid (LPA). This reaction represents the initial committed step in phospholipid and triacylglycerol biosynthesis .

The enzymatic reaction proceeds as follows:

  • Binding of glycerol-3-phosphate to the active site

  • Binding of acyl-CoA donor substrate

  • Transfer of the acyl group to the sn-1 position of glycerol-3-phosphate

  • Release of lysophosphatidic acid and CoA

Unlike mammalian systems where four GPAT isoforms exist (GPAT1-4), bacterial systems typically utilize simpler plsY mechanisms, but the fundamental catalytic function remains conserved across species .

How is recombinant L. hongkongensis plsY typically expressed and purified for research purposes?

Recombinant expression and purification of L. hongkongensis plsY typically follows this methodological workflow:

Expression System:

  • Host: E. coli expression system (typically BL21 or similar strains)

  • Vector: pET series vectors with N-terminal His-tag fusion

  • Expression conditions: Induction with IPTG (0.5-1.0 mM) at mid-log phase (OD600 ~0.6)

Purification Protocol:

  • Cell lysis: Sonication or French press in Tris/PBS-based buffer (pH 8.0)

  • Initial purification: Ni-NTA affinity chromatography

  • Intermediate wash: Imidazole gradient to remove non-specific binding proteins

  • Elution: High imidazole concentration (250-500 mM)

  • Desalting/Buffer exchange: To remove imidazole and stabilize protein

  • Optional secondary purification: Size exclusion chromatography

  • Final formulation: In Tris/PBS-based buffer with 6% trehalose (pH 8.0)

Quality Control Metrics:

  • Purity: >90% as determined by SDS-PAGE

  • Activity: Functional assays measuring conversion of glycerol-3-phosphate to lysophosphatidic acid

  • Yield: Typically 2-5 mg of purified protein per liter of bacterial culture

What are the optimal storage conditions for recombinant L. hongkongensis plsY?

For optimal stability and activity maintenance of recombinant L. hongkongensis plsY, the following storage conditions are recommended:

Short-term Storage (up to one week):

  • Temperature: 4°C

  • Buffer: Tris/PBS-based buffer, pH 8.0 with 6% trehalose

  • Form: Solution

Long-term Storage:

  • Primary recommendation: Store at -80°C

  • Alternative: -20°C (with reduced stability)

  • Form: Lyophilized powder or aliquoted solution with 50% glycerol

  • Container: Non-reactive tubes in small working aliquots

Reconstitution Protocol:

  • Centrifuge vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration

  • Aliquot for single use to avoid freeze-thaw cycles

Stability Considerations:

  • Avoid repeated freeze-thaw cycles, which significantly reduce enzyme activity

  • Working aliquots can be maintained at 4°C for up to one week

  • After reconstitution from lyophilized form, immediate aliquoting is crucial for maintaining activity

How does temperature affect the expression and activity of plsY in L. hongkongensis?

L. hongkongensis exhibits remarkable temperature adaptation mechanisms that likely extend to plsY expression and activity. While specific data for plsY is limited, parallel findings with other enzymes in L. hongkongensis provide insight into temperature-dependent regulation:

Temperature-Dependent Expression Patterns:
Based on proteomic studies of L. hongkongensis cultured at different temperatures, enzymes often show differential expression at 20°C (freshwater habitat temperature) versus 37°C (human body temperature). Similar to the well-documented case of argB isoenzymes (NAGK-20 and NAGK-37), plsY may exhibit temperature-dependent expression patterns .

Predicted Temperature-Adaptive Mechanisms:

  • Potential existence of temperature-specific isoforms

  • Post-translational modifications that alter enzymatic activity

  • Temperature-dependent shifts in substrate specificity

  • Conformational changes affecting catalytic efficiency

Research Methodology for Temperature Studies:

  • Comparative proteomics at different temperatures (20°C vs. 37°C)

  • RT-qPCR analysis of plsY expression across temperature gradient

  • Enzymatic activity assays at various temperatures

  • Thermal stability testing using differential scanning fluorimetry

These temperature-adaptive strategies likely allow L. hongkongensis to maintain membrane fluidity and integrity across its diverse habitats, from freshwater environments (20°C) to human intestines (37°C) .

What structural features of plsY contribute to its catalytic mechanism?

The catalytic mechanism of plsY involves several key structural features essential for substrate binding and acyl transfer:

Key Functional Domains:

  • Glycerol-3-phosphate binding site: Contains conserved basic residues (typically Arg/Lys) for phosphate group coordination

  • Acyl-CoA binding pocket: Predominantly hydrophobic residues forming a tunnel-like structure

  • Catalytic active site: Features His/Ser residues that facilitate nucleophilic attack

  • Transmembrane helices: Position the enzyme correctly in the membrane for substrate access

Proposed Catalytic Mechanism:

  • Ordered bi-bi mechanism where glycerol-3-phosphate binds first

  • Conformational change to recruit acyl-CoA donor

  • Acyl transfer facilitated by conserved catalytic residues

  • Sequential release of CoA followed by lysophosphatidic acid

Structure-Function Analysis Methods:

  • Site-directed mutagenesis of predicted catalytic residues

  • Inhibitor binding studies to map active site topology

  • Homology modeling based on related bacterial acyltransferases

  • Molecular dynamics simulations to visualize substrate-enzyme interactions

How might plsY contribute to the environmental adaptation of L. hongkongensis?

L. hongkongensis inhabits diverse ecological niches including freshwater environments and human/fish intestines. The plsY enzyme likely plays a significant role in this adaptability:

Adaptation Mechanisms Involving plsY:

Adaptive FunctionMolecular MechanismEcological Significance
Membrane Fluidity RegulationModulation of acyl chain composition in membrane phospholipidsEnables survival across temperature ranges (20°C-37°C)
Stress ResponseAltered phospholipid biosynthesis during environmental stressorsEnhances survival during osmotic, pH, or oxidative stress
Nutritional AdaptationUtilization of available fatty acid substratesFacilitates growth on diverse carbon sources
Biofilm FormationModified membrane composition affecting cell surface propertiesContributes to colonization of different environmental surfaces

Evidence from Genomic Analysis:
The L. hongkongensis genome reveals extensive adaptability mechanisms including metabolic versatility. The plsY gene is likely part of this adaptive toolkit, enabling the bacterium to modify its membrane composition in response to environmental signals .

Research Approaches:

  • Comparative genomics analysis of plsY across bacterial species with different habitat ranges

  • Transcriptomic profiling under various environmental conditions

  • Lipidomic analysis of membrane composition across growth conditions

  • Creation of conditional plsY mutants to assess environmental fitness

What are the potential relationships between plsY activity and L. hongkongensis virulence?

The connection between plsY activity and L. hongkongensis virulence involves several potential mechanisms:

Virulence-Associated Functions:

  • Membrane phospholipid composition affects attachment to host cells

  • Lysophosphatidic acid (LPA) production may serve as signaling molecule during infection

  • Membrane properties influence resistance to host antimicrobial peptides

  • Phospholipid metabolism supports bacterial growth during infection

Research Evidence:
While direct evidence for plsY's role in L. hongkongensis virulence is limited, genomic analysis reveals that L. hongkongensis possesses numerous putative virulence factors, including hemolysins, RTX toxins, patatin-like proteins, phospholipase A1, and collagenases. Membrane composition, influenced by plsY activity, likely affects the proper functioning of these virulence factors .

Experimental Approaches to Study Virulence Connection:

  • Creation of plsY knockdown/conditional mutants and virulence assessment

  • Transcriptomic analysis during host cell infection

  • Membrane lipid profiling during infection process

  • Inhibitor studies targeting plsY during infection models

  • Correlation analysis between plsY expression and virulence factor production

How does plsY from L. hongkongensis compare to similar enzymes in other bacteria?

Comparative analysis of L. hongkongensis plsY with homologous enzymes reveals important evolutionary and functional insights:

Evolutionary Conservation:
The plsY gene belongs to an ancient and highly conserved family of acyltransferases present across bacterial phyla, reflecting its essential role in phospholipid biosynthesis.

Comparative Features Table:

FeatureL. hongkongensis plsYE. coli plsYOther Pathogenic Bacteria plsY
Length201 amino acids~200 amino acids190-210 amino acids
Transmembrane DomainsMultiple predicted6-8 domainsVariable (5-9)
Substrate SpecificityLikely broad range of acyl-CoA donorsPreference for saturated acyl-CoASpecies-dependent preferences
Temperature AdaptabilityDual temperature functionality (20°C/37°C)Optimized for 37°CUsually optimized for host temperature
Catalytic ResiduesConserved His/Ser motifsConserved His/Ser motifsHighly conserved catalytic residues

Significance of Divergence:
The unique features of L. hongkongensis plsY likely reflect adaptations to its dual lifestyle in both environmental water and host intestines. These adaptations may include:

  • Broader substrate tolerance for available fatty acids in different environments

  • Temperature-responsive regulatory elements

  • Unique interactions with other membrane-associated proteins

What are the optimal conditions for expressing recombinant L. hongkongensis plsY in E. coli?

Optimizing recombinant expression of L. hongkongensis plsY requires careful consideration of several experimental parameters:

Vector Design Considerations:

  • Promoter selection: T7 or similar strong inducible promoter

  • Fusion tags: N-terminal His-tag for purification

  • Codon optimization: Adjust for E. coli codon bias if necessary

  • Signal sequence: Consider inclusion of pelB or similar for membrane targeting

Expression Protocol Optimization:

ParameterRecommended ConditionsRationale
E. coli StrainBL21(DE3), C41(DE3), or C43(DE3)C41/C43 strains better tolerate membrane protein expression
Growth MediaLB or 2xYT with appropriate antibioticsRich media support higher biomass
Growth Temperature30°C pre-induction, 16-25°C post-inductionLower post-induction temperature reduces inclusion body formation
Induction OD6000.6-0.8Mid-log phase balances yield and proper folding
Inducer Concentration0.1-0.5 mM IPTGLower IPTG concentrations often improve solubility
Post-induction Time16-18 hoursExtended expression at lower temperature
Harvest MethodCentrifugation at 6,500 × g for 15 minPreserves membrane integrity

Troubleshooting Strategies:

  • Screen multiple expression conditions using small-scale cultures

  • Analyze expression by Western blot and activity assays

  • Test detergent screening for membrane extraction efficiency

  • Consider fusion partners (MBP, SUMO, etc.) to improve solubility

Implementation of these optimized protocols typically yields 2-5 mg of purified recombinant plsY protein per liter of bacterial culture .

How can the enzymatic activity of plsY be measured in vitro?

Measuring plsY enzymatic activity requires specific assay systems that monitor the formation of lysophosphatidic acid (LPA) from glycerol-3-phosphate and acyl-CoA substrates:

Standard Radiometric Assay:

  • Reaction components:

    • Purified plsY enzyme (0.1-1 μg)

    • Glycerol-3-phosphate (100-500 μM)

    • [14C]- or [3H]-labeled acyl-CoA (10-100 μM)

    • Buffer system (typically 50 mM Tris-HCl, pH 7.5, 100 mM NaCl, 10 mM MgCl2)

  • Incubation at 30°C (or temperature range for kinetic studies)

  • Reaction termination with chloroform:methanol (2:1)

  • Phase separation and lipid extraction

  • Thin-layer chromatography separation

  • Quantification by scintillation counting

Coupled Enzyme Assay:

  • Monitoring CoA release using 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB)

  • Spectrophotometric detection at 412 nm

  • Calculation of activity using extinction coefficient

LC-MS/MS-Based Assay:

  • Non-radioactive approach using standard acyl-CoA substrates

  • Reaction as above but terminated with organic solvent

  • LC-MS/MS analysis of LPA formation

  • Quantification against LPA standards

Data Analysis Considerations:

  • Enzyme kinetics determination (Km, Vmax, kcat)

  • Substrate specificity profiles across acyl-CoA chain lengths

  • Inhibition studies with competitive inhibitors

  • Effects of temperature, pH, and ionic strength on activity

What approaches can be used to study the function of plsY in vivo?

Investigating plsY function in L. hongkongensis requires specialized in vivo approaches:

Genetic Manipulation Strategies:

  • Conditional knockdown systems:

    • Tetracycline-responsive promoter replacement

    • CRISPR interference (CRISPRi) targeting plsY

    • Antisense RNA expression

  • Site-directed mutagenesis:

    • Creation of catalytic site mutants

    • Membrane topology alterations

    • Substrate specificity mutations

  • Reporter fusions:

    • Transcriptional fusions to monitor expression

    • Translational fusions to track localization

    • Split-protein complementation to study interactions

Phenotypic Characterization Methods:

ApproachMethodologyInformation Gained
Growth StudiesComparative growth curves under different conditionsEssential nature and conditional requirements
Membrane AnalysisLipidomics to profile phospholipid compositionDirect impact on membrane lipid composition
Stress ResponseChallenge with membrane stressors (detergents, antimicrobials)Role in membrane integrity and stress resistance
Temperature SensitivityGrowth and membrane analysis at 20°C vs. 37°CTemperature-dependent functions
Virulence AssaysCell culture infection models or animal studiesContribution to pathogenesis

Experimental Design Considerations:

  • Include complementation controls to verify phenotype specificity

  • Use inducible systems to study essential genes

  • Implement time-course studies for dynamic processes

  • Combine with metabolic labeling to track phospholipid synthesis

How can structural studies of plsY be conducted?

Studying the structure of plsY presents challenges due to its membrane-embedded nature, requiring specialized approaches:

X-ray Crystallography Approach:

  • Protein engineering to improve crystallization properties:

    • Removal of flexible regions

    • Introduction of stabilizing mutations

    • Fusion with crystallization chaperones (e.g., T4 lysozyme)

  • Detergent screening for optimal extraction and stability

  • Lipidic cubic phase crystallization trials

  • Synchrotron radiation data collection

  • Molecular replacement using related structures

Cryo-EM Methodology:

  • Purification in amphipols or nanodiscs

  • Vitrification of sample on specialized grids

  • High-resolution image acquisition

  • Single particle analysis and 3D reconstruction

  • Model building and refinement

NMR Spectroscopy Applications:

  • Solution NMR of detergent-solubilized protein

  • Solid-state NMR for membrane-embedded state

  • Selective isotope labeling for specific region analysis

  • Dynamic studies of substrate binding

Computational Structure Prediction:

  • Homology modeling based on related acyltransferases

  • Ab initio modeling of transmembrane regions

  • Molecular dynamics simulations in membrane environment

  • Substrate docking and enzyme-substrate interactions

Complementary Structural Techniques:

What are the best methods for analyzing the substrate specificity of plsY?

Comprehensive analysis of plsY substrate specificity requires multiple complementary approaches:

In Vitro Substrate Screening:

  • Preparation of acyl-CoA library varying in:

    • Chain length (C8-C22)

    • Saturation level (saturated, mono-, and polyunsaturated)

    • Branching patterns

  • Activity assays with standardized glycerol-3-phosphate concentration

  • Kinetic parameter determination for each substrate

  • Competition assays with substrate mixtures

Structure-Function Analysis:

  • Homology modeling of substrate binding pocket

  • Site-directed mutagenesis of putative specificity-determining residues

  • Activity assays with mutant enzymes

  • Molecular docking simulations

In Vivo Lipid Profiling:

  • Expression of plsY in heterologous system

  • Supplementation with various fatty acids

  • Lipidomic analysis of resulting phospholipids

  • Correlation between supplied fatty acids and incorporation patterns

Data Visualization and Analysis:

Analysis TechniquePurposeOutput
Heat Map GenerationVisualize activity across substrate spectrumColor-coded activity profile
Principal Component AnalysisIdentify key patterns in specificityClustering of related substrates
Structure-Activity RelationshipCorrelate molecular features with activityPredictive models for activity
Kinetic Parameter ComparisonQuantitative comparison of substrate preferenceKm, Vmax, kcat/Km ratios

How should kinetic data for plsY be analyzed and interpreted?

Proper analysis of plsY kinetic data requires rigorous methodological approaches:

Steady-State Kinetics Analysis:

  • Initial velocity measurements across substrate concentration ranges

  • Linearization methods for basic parameter estimation:

    • Lineweaver-Burk plot (1/v vs. 1/[S])

    • Eadie-Hofstee plot (v vs. v/[S])

    • Hanes-Woolf plot ([S]/v vs. [S])

  • Non-linear regression fitting to Michaelis-Menten equation:
    v=Vmax×[S]Km+[S]v = \frac{V_{\max} \times [S]}{K_m + [S]}

  • For bi-substrate reactions, use of appropriate equations:

    • For ordered bi-bi mechanism: rate equations considering both substrates

    • Product inhibition patterns to determine mechanism

Temperature-Dependent Kinetics:

  • Arrhenius plot analysis (ln(k) vs. 1/T)

  • Calculation of activation energy (Ea)

  • Determination of temperature optima and thermal stability range

Inhibition Studies:

  • Competitive inhibition analysis using modified Michaelis-Menten equation:
    v=Vmax×[S]Km(1+[I]/Ki)+[S]v = \frac{V_{\max} \times [S]}{K_m(1 + [I]/K_i) + [S]}

  • Determination of inhibition constants (Ki)

  • Identification of inhibition mechanisms (competitive, uncompetitive, non-competitive)

Statistical Considerations:

  • Replicate experiments (minimum triplicate)

  • Standard error calculation for all parameters

  • Confidence interval determination

  • Outlier analysis and treatment

  • Goodness-of-fit assessment for non-linear regression

What statistical approaches are appropriate for analyzing plsY expression data?

Analysis of plsY expression data requires robust statistical frameworks:

Quantitative RT-PCR Analysis:

  • Reference gene selection and validation

  • Calculation of relative expression using 2^(-ΔΔCt) method

  • Normalization procedures for multiple reference genes

  • Statistical comparison between conditions (t-test, ANOVA)

Proteomics Data Analysis:

  • Spectral counting or intensity-based approaches

  • Normalization to total protein or housekeeping proteins

  • Fold change calculation between conditions

  • Statistical significance testing with multiple testing correction

Differential Expression Analysis Workflow:

Analysis StepMethodologyStatistical Test
Data NormalizationQuantile normalization or LOESSN/A
Variance StabilizationLog transformation or VSTLevene's test for equal variance
Differential ExpressionLinear models with empirical BayesModerated t-tests with FDR correction
Multiple Condition ComparisonLinear models with contrastsANOVA with post-hoc tests
Correlation AnalysisExpression correlation with phenotypePearson/Spearman correlation

Data Visualization:

  • Volcano plots (fold change vs. statistical significance)

  • Heat maps for expression across conditions

  • Principal component analysis for pattern identification

  • Box plots for condition comparison

Special Considerations for plsY Studies:

  • Temperature-specific expression analysis (20°C vs. 37°C)

  • Correlation with membrane lipid composition

  • Co-expression with other lipid biosynthesis enzymes

  • Temporal expression patterns during growth phases

Research on L. hongkongensis has shown significant differential protein expression between 20°C and 37°C cultures, suggesting temperature-sensitive regulation that likely extends to plsY expression patterns .

How can proteomics be used to study plsY expression under different conditions?

Proteomic approaches offer powerful tools for studying plsY expression:

2D Gel Electrophoresis Methodology:

  • Sample preparation from L. hongkongensis grown under different conditions:

    • Lysis in buffer containing 7 M urea, 2 M thiourea, and 4% CHAPS

    • Sonication and centrifugation at 16,000 × g for 20 min

  • First dimension separation:

    • Isoelectric focusing using IPG strips (pH 4-7 and 7-10)

    • Hydration with 60 μg total protein

    • IEF for approximately 100,000 volt-hours

  • Second dimension separation:

    • 12% SDS-PAGE

    • Silver staining for qualitative analysis

    • Colloidal Coomassie blue G-250 for quantitative analysis

  • Image analysis using specialized software (e.g., ImageMaster 2D Platinum)

Mass Spectrometry-Based Approaches:

  • Sample preparation:

    • In-gel digestion with trypsin for 2D gel spots

    • In-solution digestion for shotgun proteomics

  • MS analysis:

    • MALDI-TOF MS for peptide mass fingerprinting

    • LC-MS/MS for peptide sequencing and identification

  • Protein identification:

    • Database searching against L. hongkongensis sequences

    • Peptide and protein probability scoring

Quantitative Proteomics Methods:

  • Label-free quantification:

    • Spectral counting

    • MS1 intensity-based quantification

  • Labeled approaches:

    • SILAC for cell culture

    • iTRAQ or TMT for multiplexed analysis

  • Targeted proteomics:

    • Selected reaction monitoring (SRM)

    • Parallel reaction monitoring (PRM)

Data Analysis Workflow:

  • Protein identification and validation

  • Differential expression analysis

  • Pathway mapping and enrichment analysis

  • Integration with transcriptomic data

  • Correlation with phenotypic or functional data

Proteomic studies of L. hongkongensis have already revealed temperature-dependent protein expression patterns, providing a methodological framework for investigating plsY regulation under varying environmental conditions .

How can contradictions in plsY activity data be reconciled?

Resolving contradictions in plsY activity data requires systematic investigation of potential sources of variability:

Source Identification:

  • Experimental design differences:

    • Enzyme preparation methods

    • Assay conditions (pH, temperature, ionic strength)

    • Substrate quality and concentration

  • Biological variability:

    • Different expression systems

    • Post-translational modifications

    • Presence of interacting partners

  • Technical variability:

    • Detection methods

    • Calibration differences

    • Reagent quality

Methodological Reconciliation Approaches:

Reconciliation ApproachImplementationOutcome
Meta-analysisStatistical combination of multiple studiesConsensus effect size with confidence intervals
Systematic ReviewQualitative assessment of methodological differencesIdentification of key variables affecting results
Controlled Parameter VariationSystematic testing of each variableDetermination of critical parameters
Interlaboratory ValidationSame protocol performed by multiple labsAssessment of reproducibility and protocol robustness

Case Study Approaches:

  • Independent replication with detailed methodological documentation

  • Side-by-side comparison of different assay methods

  • Comparative analysis using multiple protein preparations

  • Assessment of environmental factors on enzyme stability

Reconciliation Framework:

  • Document all contradictions with methodological details

  • Identify potential sources of variability

  • Design experiments to test each variable independently

  • Establish standardized protocols

  • Report comprehensive methodological details in publications

What are the unresolved questions regarding plsY function in L. hongkongensis?

Despite advances in understanding plsY, several critical questions remain unresolved:

Key Unresolved Questions Table:

Research AreaUnresolved QuestionsExperimental Approaches
Structural BiologyWhat is the 3D structure of L. hongkongensis plsY?Cryo-EM, X-ray crystallography, molecular modeling
Temperature AdaptationDoes plsY exhibit temperature-dependent conformational changes?Comparative activity studies, thermal stability analysis, structural studies at different temperatures
Substrate SpecificityWhat is the full spectrum of acyl-donor substrates?Comprehensive substrate screening, lipidomic analysis
RegulationHow is plsY expression regulated in response to environmental signals?Promoter analysis, transcription factor identification, reporter assays
Protein InteractionsDoes plsY function in a multi-enzyme complex?Co-immunoprecipitation, bacterial two-hybrid, crosslinking studies

Technological Challenges:

  • Determining membrane protein structures at high resolution

  • Measuring real-time activity in living cells

  • Analyzing lipid dynamics in bacterial membranes

  • Developing selective inhibitors for functional studies

Biological Context Gaps:

  • Role of plsY in bacterial physiology beyond basic membrane synthesis

  • Contribution to bacterial-host interactions during infection

  • Evolutionary adaptation of plsY for dual-temperature lifestyle

  • Integration with other metabolic pathways

How can plsY be targeted for the development of antimicrobial agents against L. hongkongensis?

The essential nature of plsY in bacterial membrane biosynthesis makes it a potential antimicrobial target:

Target Validation Approaches:

  • Conditional knockdown or depletion studies to confirm essentiality

  • Chemical genetic approaches using existing inhibitors

  • Structure-based drug design targeting catalytic site

  • High-throughput screening for inhibitors

Drug Development Strategies:

StrategyMethodologyAdvantages
Active Site InhibitorsStructure-based design of competitive inhibitorsDirect inhibition of catalytic activity
Allosteric InhibitorsTargeting regulatory sitesPotentially greater specificity
Protein-Protein Interaction DisruptorsBlocking interactions with other enzymesNovel mechanism of action
Substrate MimeticsDevelopment of non-hydrolyzable substrate analogsCompetitive inhibition

Specificity Considerations:

  • Structural differences between bacterial and human acyltransferases

  • Species-specific features of plsY for selective targeting

  • Combination approaches targeting multiple steps in phospholipid synthesis

Potential Challenges:

  • Membrane permeability for inhibitor access

  • Development of resistance mechanisms

  • Off-target effects on host lipid metabolism

  • Bioavailability in infection sites

The development of plsY inhibitors could provide new therapeutic options for L. hongkongensis infections, particularly important given the emerging nature of this pathogen and limited treatment options for resistant strains.

How might advanced technologies enhance our understanding of plsY function?

Emerging technologies offer promising approaches to advance plsY research:

Cutting-Edge Methodologies:

  • CRISPR-Based Technologies:

    • CRISPRi for tunable gene repression

    • Base editing for precise point mutations

    • Prime editing for specific sequence modifications

  • Advanced Imaging Techniques:

    • Super-resolution microscopy for localization studies

    • Single-molecule tracking to monitor dynamics

    • FRET sensors for conformational changes

    • Correlative light-electron microscopy for structural context

  • Systems Biology Approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, lipidomics)

    • Flux analysis of lipid metabolic pathways

    • Network modeling of enzyme interactions

    • Machine learning for pattern identification

  • Microfluidic Applications:

    • Single-cell analysis of plsY expression

    • High-throughput screening platforms

    • Gradient systems mimicking environmental transitions

Implementation Strategies:

  • Development of reporter systems for real-time monitoring

  • Creation of biosensors for lipid intermediate detection

  • Application of nanobody technology for protein targeting

  • Integration of computational models with experimental data

Expected Outcomes:

  • Higher temporal resolution of plsY activity dynamics

  • Spatial organization within bacterial membranes

  • Context-dependent regulation mechanisms

  • Systems-level understanding of plsY in bacterial physiology

By leveraging these advanced technologies, researchers can gain unprecedented insights into the functional roles of plsY in L. hongkongensis biology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.